2.MAR.2009 14:32
NED. OCTROOIBUREAU
ACCOUNTS
43703527580
NEDERLANDSCH
OCTROOIBUREAU
cunorE/»N patent & tiiademab« attormgVs
NO.056
P.I
?

Bureau Den Haag: P.O. Box 29720 | 2502 IS The Hague | T +31(0)70 331 25 00 I F +31(0)70 352 75 28 | E-mnil: imuia;ui;iruu'vin«iu..1i
Bureau Ede: Bennekomseweg 43 I 6717 LL Ede | T 4-31(0)318 707 000 | F 4-31(0)318 707 007 I E-mail: info@octrooiburcau.nl
t~~t^.. . ...t.......^4.^.44?*-^-www,octrooibureau.nl \ .
IN* ' WKW\ ;uE! ^"WUS W
FACSIMILE
nm
i
i
i
TO:
FROM:
RE:
FAXNR:
DATE:
Federale Overheidsdienst Economie, K.M.O., Middenstand & Energie,
Koning Albert u-laan 16, B-1000 BRUSSEL, België
t,a,v, Dienst voor de Intellectuele Eigendom
Octrooiadministratie - Afdeling Vertalingen van Europese Octrooien
Europees octrooi nr, EP 1537415 ten name van Arbor Vita Corporation
Verleend op 17 december 2008 (octrooiaanvragenummer 03752248.9)
00 0 32 2 277 5275
number of pages
2 maart 2009
including this one:
280
Geachte heer, mevrouw,
Bijgevoegd een Nederlandse vertaling van bovengenoemd Europees octrooi. Een door de
octrooihouder ondertekende volmacht volgt.
De originele stukken zullen vandaag per aangetekend schrijven aan u verzonden worden.
Wij verzoeken u vriendelijk om ons als service adres te noteren.
Graag] ontvangen wij uw bevestiging van ontvangst per fax.
ndelijke groet,
ch Octrooibureau
'. ibrmelijn
[beschrijving met conclusies
;n tekeningen
1 schutblad
OPRI - DIE
02.03.2009
-1
ENTREE
HNGEKOMEN.
Deze fax is afkomstig van het Nederiandsch Octrooibureau, een adviesbureau op net terrein van de Intellectuele eigendom. De inhoud is vertrouwelijk en uitsluitend
bedoeld voor de geadresseerde. Het Is anderen dan de geadresseerde dan ook verboden om informatie uit deze fax openbaar te maken, te gebruiken of le
kopiëren. Indien u deze fax abusievelijk heeft ontvangen, wordt u vriendelijk verzocht het Nederiandsch Octrooibureau hiervan per telefoon op 070-3312500 of per
fax op 070-3527528 op de hoogte te stellen, en de fax zelf te vernietigen. Alls diensten en (andere) werkzaamheden worden aanvaard door de N.V. Nederiandsch
Octrooibureau met toepassing van de Algemene Voorwaarden en waarvan onderdeel uitmaakt een aansprakelijkheidsbeperklng. De Algemene voorwaarden zijn
gedeponeerd bij de Kamer van Koophandel te Den Haag. De N.V. Nederiandsch Octrooibureau Is gevestigd in Den Haag en ingeschreven in het handelsregister
onder nr. 27263335. De Algemene Voorwaarden kunt u vinden op en downloaden van onze website: www.octrooibureau.nl
2.MAR.2009 14:32
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
O
NO.056 P.2
NEDERLANDSCH
OCTROOIBUREAU
EUROPEAN PATENT h TRADEMARK ATTORNETS
Certified Netherlands translation of a European Patent (Art 65 EPC)
Patent number
1537415
Patentee
Arbor Vita Corporation
Application filed on
9 September 2003
Application number
03752248.9
Patent mentioned in
European Patent Bulletin
17 December 2008
W .-ht
2.MAR.2009 14:32 NED. OCTROOIBUREAU 43703527580 NO.056 P.3
ACCOUNTS
1
Werkwijzen voor het diagnosticeren van baarmoederhalskanker
Beschrijving
5 GEBIED VAN DE UITVINDING
[0001] De onderhavige uitvinding heeft betrekking op detectie van biologische
merkers van pathogène organismen zoals die welke worden waargenomen bij bepaalde
infecties met humaan papillomavirus (HPV) en werkwijzen voor het gebruik van der-
10 gelijke diagnostiek voor het identificeren van monsters die zijn geïnfecteerd en kunnen
leiden tot kankerachtige groei of andere stoornissen. De onderhavige uitvinding be-
schrijft ook samenstellingen, werkwijzen en kits voor de detectie van oncogene E6-ei-
witten van HPV in klinische monsters als een diagnostisch middel voor kanker.
15 ACHTERGROND VAN DE UITVINDING
[0002] Baarmoederhalskanker is de tweede meest algemene diagnose van kanker
bij vrouwen en is 99,7% van de keren gekoppeld aan infectie met hoog-risico humaan
papillomavirus. Op dit moment worden bij Amerikaanse vrouwen jaarlijks 12.000
20 nieuwe gevallen van invasieve baarmoederhalskanker gediagnosticeerd die elk jaar in
5.000 doden resulteren. Bovendien zijn er wereldwijd jaarlijks bij benadering 400.000
gevallen van baarmoederhalskanker en bijna 200.000 doden. Humane papilloma-virus-
sen (HPV's) zijn één van de meest algemene oorzaken van seksueel overdraagbare
ziekten in de wereld. In totaal verkrijgen 50-75% van de geslachtelijk actieve mannen
25 en vrouwen genitale HPV-infecties op een bepaald moment van hun leven. Een ge-
schatte 5,5 miljoen mensen wordt in de Verenigde Staten alleen elk jaar met HPV geïn-
fecteerd en tenminste 20 miljoen zijn op dit moment geïnfecteerd. De meer dan 100
verschillende isolaten van HPV zijn ruwweg onderverdeeld in hoog-risico en laag-ri-
sico subtypen op basis van de associatie ervan met cervicale carcinomen of met goed-
30 aardige cervicale laesies of dysplasieën. Een aantal van lijnen van bewijs wijzen HPV-
infecties aan als het etiologische agens van baarmoederhalskanker. Meerdere studies in
de jaren vanaf 1980 vermelden de aanwezigheid van varianten van HPV bij cervicale
dysplasieën, kanker en in cellijnen die afkomstig zijn van baarmoederhals-kanker. Ver-
EU 1537 415 Bl
2.MAR.2009 14:33 NED. OCTROOIBUREAU 43703527580 NO.056 P.4
ACCOUNTS
2
der onderzoek toonde dat het E6-E7 gebied van het genoom van oncogeen HPV 18 op
selectieve wijze wordt vastgehouden in cervicale kankercellen, dat suggereert dat HPV-
infectie veroorzakend zou kunnen zijn en dat aanhoudende expressie van het E6-E7
gebied nodig is voor het aanhouden van de onsterfelijke of kankerachtige toestand. In
5 de daaropvolgende jaren toonden Sedman et al., aan dat de E6-E7 genen van HPV 16
voldoende zijn voor het onsterfelijk maken van humane keratinocyten in kweek. Bar-
bosa et al,, toonden dat alhoewel E6-E7 genen van hoog-risico HPV's cellijnen kon
transformeren, de E6-E7 gebieden van laag-risico of niet-oncogene varianten zoals
HPV 6 en HPV 11 niet in staat zijn humane keratinocyten te transformeren. Meer re-
10 cent onderzochten Pillai et al., infectie met HPV 16 en 18 door in situ hybridisatie en
expressie van E6-eiwit door immunocytochemie in 623 cervicale weefselmonsters op
verscheidene fasen van tumorprogressie en vonden een aanzienlijke correlatie tussen
histologische abnormaliteit en HPV-infectie,
[0003] Modellen van huidige behandeling zijn gericht op de feitelijke cervicale
15 dysplasie in plaats van de eraan ten grondslag liggende infectie met HPV. Vrouwen
worden jaarlijks door de geneesheer gescreend op cervicale dysplasie en worden be-
handeld met oppervlakkige ablatieve technieken waaronder cryochirurgie, laser ablatie
en wegsnijding. Indien de ziekte voortgaat, worden de behandelingsopties meer agres-
sief waaronder gedeeltelijke of radiale hysterectomie, bestraling of chemotherapie. Een
20 aanzienlijke ongekende noodzaak bestaat voor vroege en nauwkeurige diagnose van
oncogene HPV-infectie alsook voor behandelingen die zijn gericht op de veroorza-
kende HPV-infectie, waarbij de ontwikkeling van baarmoederhalskanker wordt voor-
komen door eerder in de voortgang van de ziekte te interfereren. Humane papillomavi-
russen die op dit moment zijn gekarakteriseerd zijn geassocieerd met laesies die zijn
25 beperkt tot de epitheliale lagen van huid of orale, faryngeale, respiratoire en, het meest
belangrijk, anogenitale slijmvliezen. Specifieke humane papiUomavirussoorten, waar-
onder HPV 6 en 11, veroorzaken veelvuldig goedaardige mucosale beschadigingen
terwijl andere soorten zoals HPV 16, 18 en een massa van andere stammen voorname-
lijk worden gevonden in hoog-gradige beschadigingen en kanker. Afzonderlijke soor-
30 ten van humane papUlomavirussen (HPV) die mucosale oppervlakken infecteren zijn
geïmpliceerd als de veroorzakende agens voor carcinomen van de baarmoederhals,
anus, penis, larynx en de buccale holte, incidenteel periungale carcinomen alsook
goedaardige anogenitale wratten. De identificatie van specifieke HPV-soorten wordt
EU 1537 415 Bl
2.MAR.2009 14:33 NED. OCTROOIBUREAU 43703527580 NO.056 P.5
ACCOUNTS
3
gebruikt voor het identificeren van patiënten met premaligne beschadigingen die een
risico lopen op progressie naar een kwaadaardigheid. Alhoewel zichtbare anogenitale
beschadigingen aanwezig zijn bij sommige personen die zijn geïnfecteerd met humaan
papillomavirus heeft het overgrote deel van individuen met infectie van het voortplan-
5 tingskanaal door HPV geen klinisch duidelijke ziekte, maar analyse van cytomorfologi-
sche kenmerken die aanwezig zijn in de uitstrijkjes van de baarmoederhals kunnen
worden gebruikt voor het detecteren van HPV-infectie. Papanicolaou testen zijn een
waardevol hulpmiddel voor screening maar ze missen een groot deel van HPV-geïn-
fecteerde personen door de ongelukkige valse positieve en valse negatieve testresulta-
10 ten. In aanvulling zijn ze niet handelbaar voor wereldwijde testen omdat de interpretatie
van resultaten geschoolde pathologisten vereist.
[0004] Gebruikelijke virale detectietesten, waaronder serologische testen, sand-
wich ELISA-testen en groei in celkweek, zijn niet in de handel verkrijgbaar en/of zijn
niet geschikt voor de diagnose en het volgen van HPV-infectie. Sinds kort zijn ver-
15 scheidene PCR (polymerasekettingreactie) gebaseerde testen voor HPV-infecties ver-
krijgbaar. Alhoewel de testen het voordeel verschaffen van het differentiëren van onco-
gene van niet-oncogene infecties, zijn ze redelijk duur om toe te passen en vereisen
hoog geschoolde analisten voor het uitvoeren van PCR en/of luminometer testen. In
aanvulling heeft PCR een waarde van natuurlijke valse positieven die een beroep kun-
20 nen doen op verder testen of werkwijzen die niet nodig zijn. Omdat het is getoond dat
de oncogeniciteit van HPV is gebaseerd op eiwit, kan vroege detectie van DNA of
RNA van HPV leiden tot onnodige geneeskundige procedures die het immuunsysteem
van het lichaam van nature kan oplossen. De moeilijkheden bij het detecteren van on-
cogene HPV in humane monsters (bijvoorbeeld een monster van een tumor) door het
25 gebruik van traditionele werkwijzen zijn talrijk. Detectie van E6-eiwit door het gebruik
van antilichamen is bijvoorbeeld moeilijk omdat E6 dat is gemaakt in een humane cel
een aantal structurele modificaties bevat, bijvoorbeeld disulfide-bindingen en fosfaat-
groepen, die veroorzaken dat wildtype E6-eiwit dat is gemaakt in een bacterieel sys-
teem of chemisch gesynthetiseerde E6-peptiden niet E6-eiwit in humane cellen herken-
30 nen. Omdat oncogene E6-eiwitten verder niet een epitoop delen dat ze onderscheidt van
niet-oncogene E6-eiwitten, kan een enkel antilichaam niet worden gebruikt voor de
detectie van alle oncogene E6 HPV-stammen. De detectie en diagnose van ziekte is een
voorwaarde voor de behandeling van ziekte. Talrijke merkers en kenmerken van ziekte
EU 1537 415 Bl
2.MAR.2009 14:34 NED. OCTROOIBUREAU 43703527580 NO.056 P.6
ACCOUNTS
4
zijn geïdentificeerd en veel worden gebruikt voor de diagnose van ziekte. Veel ziekten
worden voorafgegaan door, en worden gekarakteriseerd door, veranderingen van de
toestand van de getroffen cellen, Veranderingen kunnen de expressie van pathogène
genen of eiwitten in geïnfecteerde cellen, veranderingen in de expressiepatronen van
5 genen of eiwitten in getroffen cellen en veranderingen in celmorfologie omvatten, De
detectie, diagnose en het volgen van ziekten kan worden geholpen door de nauwkeurige
bepaling van deze veranderingen. Goedkope, snelle, vroege en nauwkeurige detectie
van pathogenen kan het behandelen en het voorkomen mogelijk maken van ziekten die
in effect variëren van ongemak tot de dood. De volgende publicaties zijn van belang:
10 Munger (2002) Front. Biosci. 7: d641-9; Glaunsinger (2000) Oncogene 19: 5270-80;
Gardiol (1999) Oncogene 18: 5487-96; Pim (1999) Oncogene 18: 7403-8; Meschede
(1998) J. Clin. Microbiol. 36: 475-80; Kiyono (1997) Proc. Natl. Acad. Sei. 94: 11612-
6; en Lee (1997) Proc. Natl. Acad. Sei. 94: 6670-5. In aanvulling zijn de volgende oc-
trooien en octrooi-aanvragen van belang: Bleul, 6.322.794; Cole, 6.344.314; Schoolnik,
15 5.415.995; Bleul, 5753233; Cole, 5.876.723; Cole, 5.648.459; Orth, 6.391.539; Orth,
5.665.535; Schoolnik, 4.777.239.
SAMENVATTING
20 [0005] Werkwijzen en kits voor detectie van eiwitten van pathogenen die kunnen
resulteren in oncogene cellulaire transformatie of biologische abnormaliteiten in een
verscheidenheid van celsoorten (bijvoorbeeld cervicaal, anaal, penis, keel) worden
hierin verschaft. Meer in het bijzonder zijn werkwijzen en kits beschreven voor de de-
tectie van oncogene HPV E6-eiwitten in klinische monsters,
25 [0006] Eén voordeel van de uitvinding is dat veel eiwitten met een PDZ-domein,
anders dan antilichamen, binden aan de meeste of alle oncogene HPV E6-eiwitten van
humaan papillomavirus en kunnen als zodanig worden gebruikt voor het diagnosticeren
van cervicale en andere kankers. De onderhavige uitvinding maakt gebruik van een
PD2-domein polypeptide dat een Magi-l PD2-domein 2 omvat.
30 [0007] In een eerste aspect heeft de onderhavige uitvinding betrekking op een
werkwijze voor het bepalen of een humane persoon is geïnfecteerd met een oncogene
stam van humaan papillomavirus (HPV), waarbij de werkwijze omvat:
EU 1537 415 Bl
2.MAR.2009 14:35 NED. OCTROOIBUREAU 43703527580 NO.056 P.7
ACCOUNTS
5
het in contact brengen van een monster dat is verkregen van de persoon met een
PDZ-domein polypeptide dat een Magi-I PDZ-domein-2 omvat; en
het detecteren van de aanwezigheid van elk oncogeen HPV E6-eiwit dat is ge-
bonden aan het PDZ-domein polypeptide door het gebruik van een HPV bin-
5 dende partner,
waarbij de aanwezigheid van oncogeen HPV E6-eiwit aangeeft dat de persoon is geïn-
fecteerd met een oncogene stam van HPV, In een tweede aspect heeft de onderhavige
uitvinding betrekking op een kit voor het testen op de aanwezigheid van oncogeen HPV
10 E6-eiwit in een humaan monster, waarbij de kit omvat:
een eerste bindende partner voor een oncogeen HPV E6-eiwit, waarbij de eerste
bindende partner een PDZ-domein eiwit is dat een Magi-I PDZ-domein-2 omvat;
en
15 een tweede bindende partner voor het oncogene HPV E6-eiwit dat in oplossing is,
[0008] In een derde aspect heeft de onderhavige uitvinding betrekking op het ge-
bruik van een PDZ-domein polypeptide dat een Magi-I PDZ-domein 2 omvat voor het
bepalen in een in vitro test of een humane persoon is geïnfecteerd met een oncogene
20 stam van humaan papillomavirus (HPV).
KORTE BESCHRIJVING VAN DE TEKENINGEN
[0009]
25
Figuur 1 is een staafdiagram die toont dat PDZ-eiwitten op specifieke wijze oncogene
E6-eiwitten van humaan papillomavirus kunnen herkennen. Een ELISA-test werd
gebruikt om te tonen dat een PDZ-eiwit (TIP-1) specifiek E6-eiwit met de volledige
lengte van een oncogene stam (HPV18) kon herkennen maar geen enkele reactiviteit
30 toonde met een niet-oncogene stam (HPV11), Series 1 en Series 2 vertegenwoordigen
onafhankelijke proeven. E6 ab geeft aan dat een antilichaam tegen E6 van HPV18 werd
gebruikt voor detectie in plaats van het PDZ-eiwit.
EU 1537 415 Bl
2.MAR.2009 14:35 NED. OCTROOIBUREAU 43703527580 NO.056 P.8
ACCOUNTS
6
Figuur 2 is een lijndiagram die toont dat binding van PDZ aan E6 PL's van HPV18
temperatuur afhankeUjk is. Deze Figuur maakt gebruik van een gemodificeerde ELISA
voor het bepalen van binding van de PDZ-domeinen van TIP-1 of MAGI-1 (domein 2)
aan een peptide dat overeenkomt met de C-eindstandige 20 aminozuren van het E6-
5 eiwit van HPV18. Getallen in de legenda geven onafhankelijke experimenten weer. -
RT geeft aan dat de associatie werd uitgevoerd bij kamertemperatuur. Series die -RT
missen werden toegestaan te associëren bij 4°C.
Figuur 3 is een lijngrafïek die anti-HPV18E6 antilichaam herkenning van GST-
10 HPV18E6 fusie-eiwit toont. Sera van dag 28 van een Balb/c muis die is geïmmuniseerd
met HPV18E6 eiwit werd getest op reactiviteit met ofwel GST-HPV18E6 eiwit of GST
alleen.
Figuur 4 (A-D) is een paneel van vier lijngrafieken die het effect tonen van lysaat op
15 het vermogen van recombinant E6-eiwit van HPV type 16 om aan verschillende PDZ-
domeinen te binden.
Figuur 5 (A-B) is een autoradiogram die toont dat verscheidene PDZ-domeinen
oncogene E6-eiwitten van cellen kunnen binden en tezamen kunnen precipiteren.
20
Figuur 6 is een autoradiogram die de resultaten toont van een Western blot die detectie
van endogeen HPV16 E6-eiwit in de SiHa cervicale kankerlijn toont
Figuur 7 is een autoradiogram die toont dat HPV16 E6-eiwit kan worden gedetecteerd
25 in CasKi- en SiHa cervicale kankercellijnen door Western blots en detectie wordt
versterkt wanneer lysaten worden gemaakt in de aanwezigheid van Proteasoom
remmer.
Figuur 8 is een lijngrafïek die ELISA detectie van HPV16 E6-eiwit in SiHa en CasKi
30 cervicale ceUijnen toont.
Figuur 9 is een autoradiogram die dot blot detectie van HPV16 E6-eiwit in ceUysaten
toont.
EU 1537 415 Bl
2.MAR.2009 14:35 NED. OCTROOIBUREAU 43703527580 NO.056 P.9
ACCOUNTS
7
Figuur 10 is een autoradiogram die dot blot detectie van endogeen HPV16 E6-eiwit in
lysaten van SiHa en CasKi cervicale ceUijnen toont.
Figuur 11 is een autoradiogram van een Western blot die toont dat het E6-eiwit kan
5 worden gedetecteerd in een cervicale tumor die HPV16 draagt
GEDETAILLEERDE BESCHRIJVING
10
I. Definities
[0010] Een "merker" of biologische merker" zoals hierin wordt gebruikt verwijst
naar een meetbare of detecteerbare eenheid in een biologisch monster. Voorbeelden
van merkers omvatten nucleïnezuren, eiwitten of chemische middelen die aanwezig
zijn in biologische monsters. Eén voorbeeld van een merker is de aanwezigheid van
15 virale of pathogène eiwitten of nucleïnezuren in een biologisch monster van een hu-
mane bron,
[0011] Zoals hierin wordt gebruikt verwijst de term "geïsoleerd" naar een poly-
nucleotide, een polypeptide, een antilichaam of een gastheercel die in een omgeving is
die anders is dan die waarin het polynucleotide, het polypeptide, het antilichaam of de
20 gastheercel van nature voorkomt. Een polynucleotide, een polypeptide, een antilichaam
of een gastheercel dat of die is geïsoleerd is in het algemeen aanzienlijk gezuiverd.
Zoals hierin wordt gebruikt verwijst de term "aanzienÜjk gezuiverd" naar een verbin-
ding (bijvoorbeeld ofwel een polynucleotide of een polypeptide of een antilichaam) dat
van de natuurUjke omgeving ervan is verwijderd en tenminste 60% vrij is van, bij
25 voorkeur 75% vrij is van en met meeste voorkeur 90% vrij is van andere bestanddelen
waarmee het van nature is geassocieerd. Een samenstelling die A bevat is aldus
bijvoorbeeld "nagenoeg vrij van" B wanneer tenminste 85 gew.% van het totaal A+B in
de samenstelling A is, Bij voorkeur omvat A tenminste ongeveer 90 gew.% van bet
totaal van A+B in de samenstelling, met meer voorkeur tenminste ongeveer 95% of
30 zelfs 99% naar gewicht
[0012] De term "biologisch monster" omvat een verscheidenheid van soorten mon-
sters die van een organisme worden verkregen en kunnen worden gebruikt in een diag-
nostische of volgende test De term omvat bloed en andere vloeibare monsters van bio-
EU 1537 415 Bl
2.MAR.2009 14=36 NED. OCTROOIBUREAU 43703527580 NO.056 P.10
ACCOUNTS
8
logische oorsprong, vaste weefselmonsters zoals een biopsie monster of weefselkweken
of ceUen die daarvan afkomstig zijn en het nageslacht daarvan. De term omvat mon-
sters die op elke wijze zijn gemanipuleerd na het verkrijgen ervan zoals door behande-
Ung met reagens, solubüisatie of verrijking op bepaalde bestanddelen, De term omvat
5 een klinisch monster en omvat ook ceUen in celkweek, celsupernatanten, ceUysaten,
serum, plasma, biologische vloeistoffen en weefselmonsters. De term "biologisch mon-
ster" wordt bedoeld onderscheid te maken tussen een monster in een khnisch kader van
een monster dat een recombinant monster kan zijn of afkomstig is van een recombinant
monster.
10 [0013] Een persoon "geïnfecteerd" met HPV is een persoon die cellen heeft die
HPV bevatten. De HPV in de cellen hoeven niet een ander fenotype te vertonen (d.w.z.
ceUen die zijn geïnfecteerd met HPV hoeven niet kankerachtig te zijn). Met andere
woorden kunnen cellen die zijn geïnfecteerd met HPV pre-kankerachtige (d,w.z. verto-
nen niet een abnormaal fenotype anders dan die welke kunnen zijn geassocieerd met
15 virale infectie) of kankerachtige ceUen zijn.
[0014] Een "fusie-eiwit" of "fusiepolypeptide" zoals hierin wordt gebruikt verwijst
naar een samengesteld eiwit, d.w.z. een enkele opeenvolgende aminozuursequentie, die
is opgebouwd uit twee (of meer) afzonderiijke heterologe Polypeptiden die op normale
wijze niet tezamen zijn gefuseerd in een enkele aminozuursequentie. Een fusie-eiwit
20 kan aldus een enkele aminozuursequentie omvatten die twee geheel afzonderiijke ami-
nozuursequenties of twee overeenkomstige of identieke polypeptidesequenties omvat,
met dien verstande dat deze sequenties op normale wijze niet tezamen worden gevon-
den in dezelfde configuratie in een enkele aminozuursequentie die in de natuur wordt
gevonden. Fusie-eiwitten kunnen in het algemeen worden bereid door het gebruik van
25 ofwel recombinante nucleïnezuur werkwijzen, d.w.z. als een resultaat van transcriptie
en translatie van een recombinant genfusieproduct, waarbij de fusie een segment omvat
dat codeert voor een polypeptide van de uitvinding en een segment dat codeert voor een
heteroloog eiwit, of door chemische synthese werkwijzen die in het vakgebied goed
bekend zijn.
30 [0015] Een "fusie-eiwit construct" zoals hierin wordt gebruikt is een polynucleo-
tide dat codeert voor een fusie-eiwit.
[0016] Een "oncogene HPV-stam" is een HPV-stam waarvan bekend is dat het
baarmoederhalskanker veroorzaakt zoals is bepaald door het National Cancer Institute
EU 1537 415 Bl
2.MAR.2009 14:36 NED. OCTROOIBUREAU 43703527580 NO.056 P.11
ACCOUNTS
9
(NCI, 2001). "Oncogene E6-eiwitten" zijn E6-eiwitten die worden gecodeerd door de
oncogene HPV-stammen van hierboven, Illustratieve oncogene stammen zijn getoond
in Tabel 3. Oncogene stammen van HPV die hier niet specifiek zijn opgesomd zijn in
het vakgebied bekend en kunnen worden gevonden op de world wide website van het
5 National Center for Biotechnology Information (NCBI).
[0017] Een "oncogeen E6-eiwit bindende partner" kan elk molecuul zijn dat op
specifieke wijze bindt aan een oncogeen E6-eiwit Geschikte oncogeen E6-eiwit bin-
dende partners omvatten een PDZ-domein (zoals hieronder is beschreven), een antiU-
chaam tegen een oncogeen E6-eiwit; andere eiwitten die oncogeen E6-eiwit herkennen
10 (bijvoorbeeld p53, E6-AP of E6-BP); DNA (d.w.z. cruciform DNA); en andere partners
zoals aptameren of antiUchamen van een enkele keten van faagdisplay). In sommige
uitvoeringsvormen is detectie van meer dan 1 oncogeen E6-eiwit (bijvoorbeeld alle
oncogene E6-eiwitten of E6-eiwitten van HPV-stammen 16, 18 en 33) gewenst en als
zodanig kan een oncogeen E6-eiwit bindende partner antiUchaam zijn dat aan deze ei-
15 witten bindt, een mengsel van antiUchamen die elk aan een ander eiwitten binden. Zo-
als in het vakgebied bekend is kunnen dergeUjke bindende partners zijn gemerkt om de
detectie ervan te bewerkstelUgen. In het algemeen bindt een bindende partner E6 met
een bindingsaffiniteit van 10*5 M of meer, bijvoorbeeld IO"6 of meer, IO"7 of meer, 10"8
of meer (bijvoorbeeld IO"9 M, 10"10,10"n, enzovoort).
20 [0018] Zoals hierin wordt gebruikt verwijst de term 'TDZ-domein" naar een
eiwitsequentie (d.w.z. modulair eiwitdomein) van minder dan bij benadering 90 amino-
zuren (dw.z. ongeveer 80-90, ongeveer 70-80, ongeveer 60-70 of ongeveer 50-60 ami-
nozuren), gekarakteriseerd door homologie met het synaptisch eiwit van de hersenen
PSD-95, het septaat verbindende eiwit van Drosophüa Discs-Large (DLG) en het epi-
25 theUale tight junction eiwit ZOl (ZOl). PDZ-domeinen zijn ook bekend als Discs-
Large homologie herhahngen ("DHRs") en GLGF herhaüngen. PDZ-domeinen büjken
in het algemeen een kem consensussequentie aan te houden (Doyle, D.A., 1996, CeU
85: 1067-76).
[0019] PDZ-domeinen worden in diverse membraan-geassocieerde eiwitten gevon-
30 den waaronder leden van de MAGUK famüie van guanylaatkinase homologen, ver-
scheidene eiwitfosfatasen en kinasen, neuronale stikstofmonoxidesynthase, tumor-on-
derdrukkende eiwitten en verscheidene dystrofine-geassocieerde eiwitten die gezamen-
üjk bekend zijn als syntrofinen.
EU 1537 415 Bl
2.MAR.2009 14:37 NED. OCTROOIBUREAU 43703527580 NO.056 P.12
ACCOUNTS
10
[0020] IUustratieve PDZ-domein-bevattende eiwitten en PDZ-domeinsequenties
zijn in Tabel 2 en Voorbeeld 4 getoond. De term "PDZ-domein" omvat ook varianten
(bijvoorbeeld natuurUjk voorkomende varianten) van de sequenties (bijvoorbeeld po-
lymorfe varianten, varianten met conservatieve substituties en dergeUjke) en domeinen
5 van alternatieve soorten (bijvoorbeeld muis, rat). PDZ-domeinen zijn kenmerkend na-
genoeg identiek aan die welke zijn getoond in Amerikaanse octrooi-aanvraag
09/724553, bijvoorbeeld tenminste ongeveer 70%, tenminste ongeveer 80% of tenmin-
ste ongeveer 90% aminozuurresidu overeenkomst wanneer wordt vergeleken en wordt
gepositioneerd op maximale overeenkomst Het is duideUjk in het vakgebied dat PDZ-
10 domeinen kunnen worden gemuteerd teneinde aminozuurveranderingen te leveren die
binding versterken of verzwakken en om de specificiteit te veranderen, toch bUjven het
PDZ-domeinen (Schneider et al, 1998, Nat. Biotech. 17: 170-5). Tenzij anders wordt
aangegeven wordt een verwijzing naar een specifiek PDZ-domein (bijvoorbeeld een
MAGI-1 domein-2) bedoeld het specifieke PDZ-domein en de HPV E6-bindende va-
15 rianten daarvan te omvatten, Indien met andere woorden een verwijzing wordt gemaakt
naar een specifiek PDZ-domein, wordt ook een verwijzing gemaakt naar varianten van
dat PDZ-domein die oncogeen E6-eiwit van HPV binden, zoals hieronder is beschre-
ven. In dit opzicht wordt het opgemerkt dat de nummering van PDZ-domeinen in een
eiwit kan veranderen. Het MAGI-1 domein-2 zoals hierin naar wordt verwezen kan
20 bijvoorbeeld naar worden verwezen als MAGI-1 domein-1 in andere Uteratuur, Als
zodanig zou wanneer wordt verwezen naar een specifiek PDZ-domein van een eiwit in
deze aanvraag, deze verwijzing duideUjk moeten zijn met het oog op de sequentie van
dat domein, zoals hierin is beschreven, in het bijzonder in de sequentieUjst. Tabel 9 die
voor de conclusies is opgenomen toont de verhouding tussen de sequenties van de se-
25 quentieüjst en de namen en Genbank inschrijvingsnummers voor verscheidene domei-
nen, waar het geschikt is. Zoals hierin wordt gebruikt verwijst de term 'PDZ-domein"
naar een natuurUjk voorkomend eiwit dat een PDZ-domein bevat. IUustratieve PDZ-
domeinen omvatten CASK, MPP1, DLG1, DLG2, PSD95, NeDLG, 1TP-33, SYNla,
T1P-43, LDP, LIM, LIMK1, LIMK2, MPP2, NOS1, AF6, PTN-4, prIL16,41,8kD,
30 KIAA0559, RGS12, KIAA0316, DVL1, TTP-40, TIAM1, MINT1, MAGI-1, MAGI-2,
MAGI-3, KIAA0303, CBP, MLNT3, TIP-2, KIAA0561 en TEP-1. Zoals hierin wordt
gebruikt verwijst de term "PDZ-domein polypeptide" naar een polypeptide dat een
PDZ-domein bevat zoals een fusie-eiwit dat een sequentie voor een PDZ-domein om-
EU 1537 415 Bl
2.MAR.2009 14:38 NED. OCTROOIBUREAU 43703527580 NO.056 P.13
ACCOUNTS
11
vat, een natuurUjk voorkomend PDZ-eiwit of een geïsoleerd PDZ-domeinpeptide. Een
PDZ-domein polypeptide kan daarom een lengte hebben van ongeveer 60 aminozuren
of meer, een lengte van ongeveer 70 aminozuren of meer, een lengte van ongeveer 80
aminozuren of meer, een lengte van ongeveer 90 aminozuren of meer, een lengte van
5 ongeveer 100 aminozuren of meer, een lengte van ongeveer 200 aminozuren of meer,
een lengte van ongeveer 300 aminozuren of meer, een lengte van ongeveer 500 amino-
zuren of meer, een lengte van ongeveer 800 aminozuren of meer, een lengte van onge-
veer 1000 aminozuren of meer, gewoonUjk een lengte van tot ongeveer 2000 aminozu-
ren of meer. PDZ-domein peptiden zijn gewoonlijk niet meer dan 100 aminozuren (bij-
10 voorbeeld 50-60 aminozuren, 60-70 aminozuren, 80-90 aminozuren of 90-100 amino-
zuren) en coderen voor een PDZ-domein.
[0021] Zoals hierin wordt gebruikt verwijst de term "PL-eiwit" of "PDZ-Ugand
eiwit" naar een natuurlijk voorkomend eiwit dat een moleculair complex vormt met een
PDZ-domein of naar een eiwit waarvan het carboxy-uiteinde, wanneer het afzonderlijk
15 tot expressie wordt gebracht van het eiwit met de volledige lengte (bijvoorbeeld als een
peptidefragment van 4-25 residuen, bijvoorbeeld 8, 10, 12, 14 of 16 residuen) een der-
gehjk moleculair complex vormt. Het moleculaire complex kan in vitro worden waar-
genomen door het gebruik van de "A-test" of "G-test" die hieronder is beschreven of in
vivo, niustratieve PL-eiwitten die zijn opgesomd in TabeUen 3 en 4 zijn getoond speci-
20 fieke PDZ-eiwitten te binden. Deze definitie is niet bedoeld anti-PDZ antüichamen en
dergeUjke te omvatten. Zoals hierin wordt gebruikt verwijst een "PL-sequentie" naar de
aminozuursequentie van het C-uiteinde van een PL-eiwit (bijvoorbeeld de C-eindstan-
dige 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 20 of 25 residuen) ("C-eindstandige Pl^se-
quentie") of naar een inteme sequentie waarvan bekend is dat het een PDZ-domein
25 bindt ("interne PL-sequentie"). Zoals hierin wordt gebruikt is een "PL-peptide" een
peptide dat een sequentie heeft van, of gebaseerd is op, de sequentie van het C-uiteinde
van een PL-eiwit. niustratieve PL-peptiden (gebiotinyleerd) zijn opgesomd in Tabel 3,
Zoals hierin wordt gebruikt is een "PL-detector" een eiwit dat op specifieke wijze een
Pl^sequentie kan herkennen en kan binden. Zoals hierin wordt gebruikt is een "PL-
30 fusie-eiwit" een fusie-eiwit dat een PL-sequentie heeft als één domein, kenmerkend als
het C-eindstandige domein van het fusie-eiwit Een ülustratief PL-fusie-eiwit is een
fusie van tat-PL sequentie. Zoals hierin wordt gebruikt verwijst de term "PL remmende
peptidesequentie" naar een aminozuursequentie van een PL-peptide dat (in de vorm van
EU 1537 415 Bl
2.MAR.2009 14:38 NED. OCTROOIBUREAU 43703527580 NO.056 P.14
ACCOUNTS
12
een peptide of PL-fusie-eiwit) de interactie tussen een PDZ-domein polypeptide en een
PL-peptide remt (bijvoorbeeld in een A-test of een G-test). Zoals hierin wordt gebruikt
betekent een 'TDZ-domein coderende sequentie" een segment van een polynucleotide
dat codeert voor een PDZ-domein. In verscheidene uitvoeringsvormen is het polynu-
5 cleotide DNA, RNA, enkelstrengs of dubbelstrengs. Zoals hierin wordt gebruikt wor-
den de termen "antagonist" en "remmer" wanneer ze worden gebruikt in de samenhang
van het moduleren van een bindingsinteractie (zoals de binding van een PDZ-domein-
sequentie aan een PL-sequentie) onderling uitwisselbaar gebruikt en verwijzen naar een
middel dat de binding van de bijvoorbeeld PL-sequentie (bijvoorbeeld PL-peptide) en
10 de bijvoorbeeld PDZ-domeinsequentie (bijvoorbeeld PDZ-eiwit, PDZ-domeinpeptide),
verlaagd.
[0022] Zoals hierin wordt gebruikt worden de termen "agonist" en "versterker"
wanneer ze worden gebruikt in de samenhang van het moduleren van een bindingsin-
teractie (zoals de binding van een PDZ-domein sequentie aan een PL-sequentie) onder-
15 ling uitwisselbaar gebruikt en verwijzen naar een middel dat de binding van de bijvoor-
beeld PL-sequentie (bijvoorbeeld PL-peptide) en de bijvoorbeeld PDZ-domeinsequen-
tie (bijvoorbeeld PDZ-eiwit, PDZ-domeinpeptide) verhoogt.
[0023] Zoals hierin wordt gebruikt worden de termen "peptide nabootser",
"peptidomimetic" en "peptide-analoog" onderling uitwisselbaar gebruikt en verwijzen
20 naar een synthetische chemische verbinding die nagenoeg dezelfde structurele en/of
functionele kenmerken van een PL-remmende of PL-bindend peptide van de uitvinding
heeft De nabootser kan ofwel geheel zijn samengesteld uit synthetische, niet-natuur-
üjke analoga van aminozuren of is een chimeer molecuul van gedeelteüjk natuurUjke
peptide aminozuren en gedeeltelijk niet-natuurüjke analoga van aminozuren. De na-
25 bootser kan ook elke hoeveelheid van conservatieve substituties van natuurUjke amino-
zuren incorporeren zolang dergeUjke substituties niet aanzienÜjk de structuur en/of de
remmende of bindende activiteit van de nabootser veranderen. Zoals met de Polypepti-
den van de uitvinding die conservatieve varianten zijn, zuUen routine experimenten
bepalen of een nabootser binnen de beschermingsomvang van de uitvinding valt, d.w.z.
30 dat de structuur en/of functie ervan niet aanzienlijk is veranderd. Een samenstelling van
een nabootser valt binnen de beschermingsomvang van de uitvinding indien het in staat
is te binden aan een PDZ-domein en/of een PL-PDZ interactie te remmen.
EU 1537 415 Bl
2.MAR.2009 14:39 NED. OCTROOIBUREAU 43703527580 NO.056 P.15
ACCOUNTS
13
[0024] Polypeptide nabootsende samenstellingen kunnen elke combinatie van niet-
natuuriijke structurele bestanddelen bevatten die kenmerkend van drie structurele groe-
pen zijn: a) residu-koppelende groepen anders dan de natuurUjke amide-binding ("pep-
tide-binding") koppelingen; b) niet-natuurüjke residuen in plaats van natuurUjk voor-
5 komende aminozuurresiduen; of c) residuen die secundaire structurele mimicry induce-
ren, d.w.z. voor het induceren of stabiliseren van een secundaire structuur, bijvoorbeeld
een bèta-draaiing, gamma-draaiing, bèta-plaat, alfa-helix conformatie en dergelijke.
[0025] Een polypeptide kan worden gekarakteriseerd als een nabootser wanneer
alle of sommige van de residuen ervan zijn verbonden door chemische wijzen die an-
10 ders zijn dan natuurUjke peptidebindingen. Afzonderiijke peptidomimetic residuen
kunnen worden verbonden door peptidebindingen, andere chemische bindingen of kop-
pelende wijzen zoals bijvoorbeeld glutaaraldehyde, N-hydroxysuccinimide-esters, bi-
functionele maleïmiden, N,N=dicyclohexylcarbodiimide (DCC) of N,N=-diisopropyl-
carbodiimide (DIC). Koppelende groepen die een alternatief kunnen zijn voor de tradi-
15 tionele amide-binding ("peptidebinding") koppelingen omvatten bijvoorbeeld ketome-
thyleen (bijvoorbeeld -C(=0)-CH2- voor -C(=0)-NH-), amino-methyleen (CH2-NH),
ethyleen, olefine (CH=CH), ether (CH2-O), thioéther (CH2-S), tetrazool (CN4-), thia-
zool, retroamide, thioamide, of ester (zie bijvoorbeeld Spatola (1983) in Chemistry and
Biochemistry of Amino Acids, Peptides and Proteins, Vol. 7, blz. 267-357, A Peptide
20 Backbone Modifications, MarceU Dekker, NY).
[0026] Een polypeptide kan ook worden gekarakteriseerd als een nabootser door
het bevatten van alle of enige niet-nahiurüjke residuen in plaats van natuurUjk voorko-
mende aminozuurresiduen. Niet-natuurüjke residuen zijn goed beschreven in de weten-
schappeUjke en octrooiüteratuur; een paar illustratieve niet-natuurüjke samen-stellin-
25 gen die bruikbaar zijn als nabootsers van natuurUjke aminozuurresiduen en richtUjnen
zijn hieronder beschreven.
[0027] Nabootsers van aromatische aminozuren kunnen worden gegenereerd door
het vervangen door bijvoorbeeld D- of I^nafylalanine; D- of L-fenylglycine; D- of L-2-
thieneylalanine; D- of L-l, -2, 3-, of 4- pyreneylalanine; D- of L-3-thieneylalanine; D-
30 of L-(2-pyridinyl)-alanine; D- of I^(3-pyridinyl)-alanine; D- of I^(2-pyrazinyl)-ala-
nine; D- of L-(4-isopropyl)-fenylglycine; D-(trifluormethyl)-fenylglycine; D- (trifluor-
methyl)-fenylalanine; D-p-fluorfenylalanine; D- of L-p-bifenylfenylalanine; K- of L-p-
methoxybifenylfenylalanine; D- of L-2-indool(alkyl)alaninen; en D- of I^alkylainines,
EU 1537 415 Bl
2.MAR.2009 14:39 NED. OCTROOIBUREAU 43703527580 NO.056 P.16
ACCOUNTS
14
waarbij alkyl gesubstituteerd of niet-gesubstituteerd methyl, ethyl, propyl, hexyl, butyl,
pentyl, isopropyl, iso-butyl, sec-isotyl, iso-pentyl, of niet-zure aminozuren kan zijn.
Aromatische ringen van een niet-natuurÜjk aminozuur omvatten bijvoorbeeld thiazolyl,
thiofenyl, pyrazolyl, benzimidazolyl, nafthyl, furanyl, pyrrolyl en pyridyl aromatische
5 ringen.
[0028] Nabootsers van zure aminozuren kunnen worden gegenereerd door
substitutie door bijvoorbeeld niet-carboxylaat aminozuren terwijl een negatieve lading
wordt aangehouden; (fosfono)alanïne; gesulfateerd threonine. Carboxyl zij groepen
(bijvoorbeeld aspartyl of glutamyl) kunnen ook op selectieve wijze worden gemodifi-
10 ceerd door reactie met carbodiimiden (R=-N-C-N-R=) zoals bijvoorbeeld 1-cyclohexyl-
3(2-morfolmyl-(4-emyl)carbodiimide of l-ethyl-3(4-azonia-4,4- dimethol-pentyl)car-
bodiimide, Aspartyl of glutamyl kunnen ook worden omgezet naar asparaginyl en glu-
taminyl residuen door reactie met ammoniumionen.
[0029] Nabootsers van basische aminozuren kunnen worden gegenereerd door sub-
15 stitutie met bijvoorbeeld (in aanvulling op lysine en arginine) de aminozuren ornithine,
citmlline, of (guanidino)-azijnzuur of (guanidino)alkyl-azijnzuur, waarbij alkyl hierbo-
ven is gedefinieerd. Nitril derivaat (bijvoorbeeld die de CN-groep in plaats van COOH
bevat) kan worden gesubstitueerd voor een asparagine of glutamine. Asparaginyl en
glutaminyl residuen kunnen worden gedeamineerd naar de overeenkomstige aspartyl of
20 glutamylresiduen.
[0030] Arginine-residu nabootsers kunnen worden gegenereerd door het in reactie
brengen van arginyl met bijvoorbeeld één of meer gebruikehjke reagens waaronder
bijvoorbeeld fenylglyoxal, 2,3-butaandion, 1,2-cyclohexaandion, of ninhydrine, bij
voorkeur onder alkalische omstandigheden.
25 [0031] Tyrosine-residu nabootsers kunnen worden gegenereerd door tyrosyl in
reactie te brengen met bijvoorbeeld aromatische diazonium verbindingen of tetranitro-
methaan. N-acetylimidizol en tetranitromethaan kunnen worden gebruikt voor het vor-
men van respectieveUjk O-acetyl tyrosyl soorten en 3-nitro derivaten.
[0032] Cysteïne-residu nabootsers kunnen worden gegenereerd door het in reactie
30 brengen van cysteïnyl residuen met bijvoorbeeld alfa-halogeenacetaten zoals 2-chloor-
azijnzuur of chlooracetamide en overeenkomstige amines, voor het leveren van car-
boxyméthyl of carboxyamidomethyl derivaten. Cysteïne-residu nabootsers kunnen ook
worden gegenereerd door het in reactie brengen van cysteïnyl-residuen met bijvoor-
EU 1537 415 Bl
2.MAR.2009 14:40 NED. OCTROOIBUREAU 43703527580 NO.056 P.17
ACCOUNTS
15
beeld broom-trifluoraceton, alfa-broom-bèta-(5-imidozoyl)propionzuur; chloor-acetyl-
fosfaat N-alkylmaleïmiden, 3-nitro-2-pyridyldisulfide; methyl-2-pyridyI-disulfide; p-
chloormercuribenzoaat; 2-chloonnercuri-4-nitrofenol; of chloor-7-nitrobenzo-oxa-l,3-
diazool.
5 [0033] Lysine nabootsers kunnen worden gegenereerd (en amino-eindstandige
residuen kunnen worden veranderd) door het in reactie brengen van lysinyl met bij-
voorbeeld bamsteenzuur of andere carbonzuuranhydriden. Lysine en andere alfa-
amino-bevattende residu nabootsers kunnen ook worden gegenereerd door reactie met
imido-esters zoals memylpicoUnimidaat, pyridoxalfosfaat, pyridoxal, chloor-boorhy-
10 dride, trinitrobeiizeensulfonzuur, O-methyUsoureum, 2,4-pentaandion en transamidase-
gekatalyseerde reacties met glyoxylaat.
[0034] Nabootsers van methionine kunnen worden gegenereerd door reactie met
bijvoorbeeld methioninesulfoxide. Nabootsers van proline omvatten bijvoorbeeld pipe-
colinezuur, thiazolidinecarbonzuur, 3- of 4-hydroxyproline, dehydroproline, 3- of 4-
15 methylproUne, of 3,3-dimethylproline. Histidine-residu nabootsers kunnen worden ge-
genereerd door histidyl in reactie te brengen met bijvoorbeeld diethylprocarbonaat of
para-broomfenacylbromide.
[0035] Andere nabootsers omvatten bijvoorbeeld die welke zijn gegenereerd door
hydroxylatie van proline en lysine; fosforylatie van de hydroxylgroepen van seryl of
20 threonyl-residuen; methylatie van de alfa-aminogroepen van lysine, arginine en histi-
dine; acetylatie van de N-eindstandige amine; methylatie van de amide-residuen van de
hoofdketen of substitutie met N-methyl aminozuren; of amidatie van C-eindstandige
carboxylgroepen.
[0036] Een bestanddeel van een natuurUjk polypeptide (bijvoorbeeld een PL-poly-
25 peptide of PDZ-polypeptide) kan worden vervangen door een aminozuur (of peptide-
nabootsend residu) met de tegengestelde chiraliteit. Elk aminozuur dat van nature
voorkomt in de L-configuratie (waarnaar ook kan worden verwezen als de R of S af-
hankeUjk van de structuur van de chemische eenheid) kan worden vervangen met het
aminozuur van dezelfde chemisch structurele soort of een peptidomimetic, maar met de
30 tegengestelde chirahteit waarnaar in het algemeen wordt verwezen als het D-amino-
zuur, maar waarnaar ook kan worden verwezen als de R- of S-vorm.
[0037] De nabootsers van de uitvinding kunnen ook samenstellingen omvatten die
een structureel nabootsend residu bevatten, in het bijzonder een residu dat secundaire
EU 1 537 415 Bl
2.MAR.2009 14:40 NED. OCTROOIBUREAU 43703527580 NO.056 P.18
ACCOUNTS
16
structuren induceert of nabootst zoals een bèta-draaiing, bèta-plaat alfa-helix structu-
ren, gamma-draaiingen en dergeUjke. Substitutie van natuurlijke aminozuur-residuen
met D-aminozuren; N-alfa-methyl-aminozuren; C-alfa-methyl-aminozuren; of dehy-
droaminozuren in een peptide kan bijvoorbeeld bèta-draaiingen, gamma-draaiingen,
5 bèta-platen of alfa-helix confonnaties induceren of stabiUseren. Bèta-draaiing naboot-
sende structuren zijn bijvoorbeeld beschreven door Nagai (1985) Tet. Lett. 26: 647-
650; Feigl (1986) J. Amer. Chem. Soc. 108: 181-182; Kahn (1988) J. Amer. Chem,
Soc. 110: 1638- 1639; Kemp (1988) Tet Lett. 29: 5057-5060; Kahn (1988) J. Molec.
Recognition 1: 75-79. Bèta-plaat nabootsende structuren zijn bijvoorbeeld beschreven
10 door Smith (1992) J. Amer. Chem. Soc. 114: 10672-10674. Een type VI bèta-draaiing
geïnduceerd door een cis-amide surrogaat, 1,5-digesubstitueerd tétrazol, is bijvoorbeeld
beschreven door Beusen (1995) Biopolymers 36: 181-200, Incorporatie van achirale
omega-aminozuurresiduen voor het genereren van polymethyleen eenheden als een
substitutie voor amidebindingen is beschreven door Banerjee (1996) Biopolymers 39:
15 769-777. Secundaire structuren van Polypeptiden kunnen worden geanalyseerd door
bijvoorbeeld high-field IH NMR of 2D NMR spectroscopie, zie bijvoorbeeld Higgins
(1997) J. Pept. Res. 50: 421-435. Zie ook Hruby (1997) Biopolymers 43: 219-266, Ba-
laji, et al., Amerikaans octrooischrift-nummer 5.612.895.
[0038] Zoals hierin wordt gebruikt verwijzen "peptidevarianten" en "conservatieve
20 aminozuursubstituties" naar peptiden die van een referentiepeptide verschÜlen (bij-
voorbeeld een peptide dat de sequentie van het carboxy-uiteinde van een gespecificeerd
PL-eiwit heeft) door substitutie van een aminozuurresidu dat overeenkomstige eigen-
schappen heeft (op basis van grootte, polariteit hydrofobiciteit, en dergeUjke). Tot zo-
ver de verbindingen die zijn opgenomen in de beschermings-omvang van de uitvinding
25 gedeeltetijk zijn gedefinieerd in termen van aminozuurresiduen van aangeduide klas-
sen, kunnen de aminozuren in het algemeen worden gecategoriseerd in drie hoofdklas-
sen: hydrofiele aminozuren, hydrofobe aminozuren en cysteïne-achtige aminozuren,
voornameüjk afhankeUjk van de kenmerken van de aminozuurzijketen. Deze hoofd-
klassen kunnen verder worden verdeeld in subklassen. Hydrofiele aminozuren omvat-
30 ten aminozuren die zure, basische of polaire zijketens hebben en hydrofobe aminozuren
omvatten aminozuren die aromatische of apolaire zijketens hebben. Apolaire aminozu-
ren kunnen verder worden onderverdeeld om onder andere alifatische aminozuren te
EU 1537 415 Bl
2.MAR.2009 14:41 NED. OCTROOIBUREAU 43703527580 NO.056 P.19
ACCOUNTS
17
omvatten. De definities van de klassen van aminozuren zoals ze hierin worden gebruikt
zijn als volgt;
"Hydrofoob aminozuur" verwijst naar een aminozuur dat een zijketen heeft die
5 niet geladen is bij fysiologische pH en dat wordt afgestoten door een waterige
oplossing, Voorbeelden van genetisch gecodeerde hydrofobe aminozuren omvat-
ten He, Leu en Val. Voorbeelden van niet-genetisch gecodeerde hydrofobe ami-
nozuren omvatten t-BuA.
"Aromatisch aminozuur" verwijst naar een hydrofoob aminozuur dat een zijketen
10 heeft die tenminste één ring bevat die een geconjugeerd 7t-elektron systeem (aro-
matische groep) heeft. De aromatische groep kan verder worden gesubstitueerd
met groepen zoals alkyl, alkenyl, alkynyl, hydroxyl, sulfanyl, nitro en amino-
groepen alsook andere. Voorbeelden van genetisch gecodeerde aromatische ami-
nozuren omvatten Phe, Tyr en Trp. Algemeen bekende niet-genetisch gecodeerde
15 aromatische aminozuren omvatten fenylglycine, 2-nafthylalanine, ß-2-thienylala-
nine, l,2,3,4-tetrahydro-isoquinoUne-3-carbonzuur, 4-chloor-fenylalanine, 2-
fluorfenyl-alanine, 3-fluorfenylalanine en 4-fluor-fenylalanine.
"Apolair aminozuur" verwijst naar een hydrofoob aminozuur dat een zijketen
heeft die in het algemeen niet geladen is bij fysiologische pH en die niet polair is.
20 Voorbeelden van genetisch gecodeerde apolaire aminozuren omvatten Gly, Pro
en Met. Voorbeelden van niet-gecodeerde apolaire aminozuren omvatten Cha.
"Alifatisch aminozuur" verwijst naar een apolair aminozuur dat een verzadigde of
onverzadigde rechte keten, vertakte of cydische koolwaterstof zijketen heeft.
Voorbeelden van genetisch gecodeerde alifatische aminozuren omvatten Ala,
25 Leu, Val en He. Voorbeelden van niet-gecodeerde alifatische aminozuren omvat-
ten Nie.
"Hydrofiel aminnwmr" verwijst naar een aminozuur dat een zijketen heeft die
wordt aangetrokken door een waterige oplossing. Voorbeelden van genetisch ge-
codeerde hydrofiele aminozuren omvatten Ser en Lys. Voorbeelden van niet-ge-
30 codeerde hydrofiele aminozuren omvatten Cit en hCys.
r
"Zuur aminozuur" verwijst naar een hydrofiel aminozuur dat een pK-waarde van
de zijketen heeft van lager dan 7. Zure aminozuren hebben kenmerkend negatief
EU 1537 415 Bl
2.MAR.2009 14:41 NED. OCTROOIBUREAU 43703527580 NO.056 P.20
ACCOUNTS
18
geladen zijketens bij fysiologische pH door veriies van een waterstof-ion. Voor-
beelden van genetisch gecodeerde zure aminozuren omvatten Asp en Glu.
"Basisch aminozuur" verwijst naar een hydrofiel aminozuur dat een pK-waarde
van de zijketen heeft van hoger dan 7. Basische aminozuren hebben kenmerkend
5 positief geladen zijketens bij fysiologische pH door associatie met hydronium-
ion. Voorbeelden van genetisch gecodeerde basische aminozuren omvatten Arg,
Lys en His. Voorbeelden van niet-genetisch gecodeerde basische aminozuren
omvatten de niet-cycüsche aminozuren ornithine, 2,3-diaminopropionzuur, 2,4-
diaminoboterzuur en homo-arginine.
10 "Polair aminozuur" verwijst naar een hydrofiel aminozuur dat een zijketen heeft
die niet geladen is bij fysiologische pH maar die een binding heeft waarin het
paar van elektronen die gezamenhjk worden gedeeld door twee atomen meer in
de nabijheid wordt gehouden van één van de atomen. Voorbeelden van genetisch
gecodeerde polaire aminozuren omvatten Asx en Glx. Voorbeelden van niet ge-
15 netisch gecodeerde polaire aminozuren omvatten citrulline, N-acetyl lysine en
methioninesulfoxide,
"Cysteïhe-achtig aminozuur" verwijst naar een aminozuur dat een zijketen heeft
die in staat is een covalente koppeling te vormen met een zijketen van een ander
aminozuurresidu, zoals een disulfide-koppeling. Cysteïne-achtige aminozuren
20 hebben kenmerkend in het algemeen een zijketen die tenminste één thiol (SH)
groep bevat Voorbeelden van genetisch gecodeerde cysteïne-achtige aminozuren
omvatten Cys. Voorbeelden van niet genetisch gecodeerde cysteïne-achtige ami-
nozuren omvatten homocysteine en penicülamine.
25 [0039] Zoals voor de deskundige in het vakgebied duideUjk zal zijn, is de
classificatie van hierboven niet absoluut - verscheidene aminozuren vertonen meer dan
één kenmerkende eigenschap en kunnen daardoor worden opgenomen in meer dan één
categorie. Tyrosine heeft bijvoorbeeld zowel een aromatische ring en een polaire hy-
droxylgroep. Tyrosine heeft aldus tweeledige eigenschappen en kan worden opgeno-
30 men in zowel de aromatische en polaire categorieën. Op overeenkomstige wijze heeft
cysteine in aanvuUing op het in staat te zijn om disulfide-koppelingen te vormen ook
een apolair karakter. Terwijl het aldus niet strikt wordt geclassificeerd als een hydro-
EU 1537 415 Bl
2.MAR.2009 14:42 NED. OCTROOIBUREAU 43703527580 NO.056 P.21
ACCOUNTS
19
foob of apolair aminozuur, kan in veel gevallen cysteine worden gebruikt voor het ver-
lenen van hydrofobiciteit aan een peptide.
[0040] Bepaalde algemeen bekende aminozuren die niet genetisch worden geco-
deerd waaruit de peptiden en peptide analoga van de uitvinding kunnen zijn samenge-
5 steld omvatten, maar zijn niet beperkt tot, ß-alanine (b-Ala) en andere omega-aminozu-
ren zoals 3-aminopropionzuur (Dap), 2,3-diaminopropionzuur (Dpr), 4-aminoboterzuur
enzovoort; a-aminoisoboterzuur (Aib); e-aminohexaanzuur (Aha); 8-aminovaleriaan-
zuur (Ava); N-methylglycine of sarcosine (MeGly); ornithine (Om); citruüine (Cit); t-
butylalanine (t-BuA); t-butylglycine (t-BuG); N-methyüsoleucine (MeUe); fenylglycine
10 (Phg); cyclohexylalanine (Cha); norleucine (Nie); 2-nafthyl-alanine (2-Nal); 4-chloor-
fenylalanine (Phe(4-Cl) ); 2-fluorfenylalanine (Phe(2-F)); 3-fluorfenylalanine (Phe(3-
F)); 4-fluorfenylalanine (Phe(4-F)); penicülamine (Pen); 1,2,3,4-tetrahydro-isoquino-
line-3-carbonzuur (Tic); ß-2-thienylalanine (Thi); methioninesulfoxide (MSO); homo-
arginine (hArg); N-acetyUysine (AcLys); 2,3-diaminoboterzuur (Dab); 2,3-diaminobo-
15 terzuur (Dbu); p-aminofenylalanine (Phe(pNH2)); N-methylvaline (MeVal); homocys-
teine (hCys) en homoserine (hSer). Deze aminozuren vaUen op geschikte wijze ook in
de categorieën die hierboven zijn gedefinieerd.
[0041] De classificatie van de hierboven beschreven genetisch gecodeerde en niet-
gecodeerde aminozuren is samengevat in Tabel 1 hieronder. Het moet duideUjk zijn dat
20 Tabel 1 alleen voor iUustratieve doelen is en niet is bedoeld een uitputtende opsomming
te zijn van aminozuurresiduen die de peptiden en peptide-analoga die hierin zijn be-
schreven kunnen omvatten. Andere aminozuurresiduen die bruikbaar zijn voor het ma-
ken van de peptiden en peptide-analoga die hierin zijn beschreven kunnen bijvoorbeeld
worden gevonden in Fasman, 1989, CRC Practical Handbook of Biochemistry and
25 Molecular Biology, CRC Press, Inc., en de referenties die daarin zijn geciteerd Amino-
zuren die hierin niet specifiek worden genoemd kunnen op geschikte wijze worden ge-
classificeerd in de hierboven beschreven categorieën op basis van bekend gedrag en/of
de kenmerkende chemische en/of fysiologische eigenschappen ervan in vergeUjking
met aminozuren die specifiek zijn geïdentificeerd.
30
EU 1537 415 Bl
2.MAR.2009 14:42
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.056
P. 22
20
Tabel 1
Classificatie Genetisch gecodeerd Genetisch niet gecodeerd
Hydrofoob
Aromatisch F.Y.W Phg, Nal, Thi, Tic, Phe(4-Cl), Phe(2-F), Phe(3-F), Phe(4-F), Pyridyl Ala, Benzothiënyl Ala
Apolair M,G,P t-BuA, t-BuG, Melle, Nie, MeVal, Cha, bAla, MeGly, Aib
Alifatisch A,V,L,I
Hydrofiel Dpr, Om, hArg, PheCp-NHz), DBU, A3BU
Zuur D,E Cit, AcLys, MSO, hSer
Basisch H,K,R Pen, hCys, p-methyl Cys
Polair Q, N, S, T. Y
Cysteïne-achtig C
[0042] In het geval van de PDZ-domeinen die hierin zijn beschreven is een "HPV
E6-bindende variant" van een specifiek PDZ-domein een variant van het PDZ-domein
5 dat de Ugand-bindende activiteit van HPV E6 PDZ behoudt. Testen voor het bepalen of
een variant van het PDZ-domein E6 van HPV bindt zijn in sterk detail hieronder be-
schreven en richtiijnen om te identificeren welke aminozuren in een specifiek PDZ-
domein moeten worden veranderd om het een variant te maken, kunnen worden gevon-
den in een verscheidenheid van bronnen. In één voorbeeld kan een PDZ-domein wor-
10 den vergeleken met andere PDZ-domeinen die hierin zijn beschreven en aminozuren op
overeenkomstige posities kunnen bijvoorbeeld worden gesubstitueerd. In een ander
voorbeeld kan de sequentie van een PDZ-domein van een specifiek PDZ-eiwit worden
vergeleken met de sequentie van een geUjkwaardig PDZ-domein in een geüjkwaardig
PDZ-eiwit van een andere soort. De sequentie van een PDZ-domein van een humaan
15 PDZ-domein kan bijvoorbeeld worden vergeleken met de sequentie van andere be-
kende en geüjkwaardige PDZ-domeinen van andere soorten (bijvoorbeeld muis, rat,
enzovoort) en alle aminozuren die variant zijn tussen de twee sequenties kunnen wor-
den gesubstitueerd in het humane PDZ-domein voor het maken van een variant van het
PDZ-domein. De sequentie van het humane MAGI-1 PDZ-domein 2 kan bijvoorbeeld
20 worden vergeleken met geüjkwaardige MAGI-1 PDZ-domeinen van andere soorten
(bijvoorbeeld muis Genbank gi nummers 7513782 en 28526157 of andere homologe
sequenties) voor het identificeren van aminozuren die kunnen worden gesubstitueerd in
EU 1537 415 Bl
2.MAR.2009 14:43 NED. OCTROOIBUREAU 43703527580 NO.056 P.23
ACCOUNTS
21
het humane MAGI-1 PDZ-domein om een variant daarvan te maken. Een dergeUjke
werkwijze kan worden toegepast op elk van de MAGI-1 PDZ-domeinen die hierin zijn
beschreven. Minimale sequentie van MAGI-PDZ domein 2 wordt verschaft als SEQ ID
NO's: 293-301. Specifieke varianten kunnen 1 tot 5, tot ongeveer 10, tot ongeveer 15,
5 tot ongeveer 15, tot ongeveer 20 of tot ongeveer 30 of meer, gewoonUjk tot ongeveer
50 aminozuur veranderingen hebben in vergeUjking met een sequentie die uiteengezet
is in de sequentielijst. Illustratieve MAGI-1 PDZ varianten omvatten de sequenties die
uiteengezet zijn in SEQ ID NO's: 302-330. Bij het maken van een variant zou, indien
een GFG-motief aanwezig is in een PDZ-domein, het in het algemeen niet veranderd
10 moeten worden in sequentie.
[0043] In het algemeen hebben variante PDZ-domein Polypeptiden een PDZ-do-
mein dat tenminste ongeveer 70 of 80%, gewoonUjk tenminste ongeveer 90% en meer
gewoonUjk tenminste ongeveer 98% sequentie-overeenkomst heeft met een variant
PDZ-domein polypeptide dat hierin is beschreven, zoals wordt gemeten door BLAST
15 2.0 door het gebruik van standaard parameters over een gebied dat zich uitstrekt over
het gehele PDZ-domein.
[0044] Zoals hierin wordt gebruikt heeft een "detecteerbare merker" de gewoon-
üjke betekenis in het vakgebied en verwijst naar een atoom (bijvoorbeeld radionucUde),
molecuul (bijvoorbeeld fluoresceïne) of complex dat wordt of kan worden gebruikt
20 voor het detecteren (bijvoorbeeld door een fysische of chemische eigenschap), het aan-
geven van de aanwezigheid van een molecuul of het mogeUjk maken van binding van
een ander molecuul waar aan het op covalente wijze is gebonden of op andere wijze is
geassocieerd. De term "merker" verwijst ook naar covalent gebonden of op andere
wijze geassocieerde moleculen (bijvoorbeeld een biomolecuul zoals een enzym) die
25 inwerken op een substraat voor het produceren van een detecteerbare atoom, molecuul
of complex. Detecteerbare merkers die geschikt zijn voor gebruik in de onderhavige
uitvinding omvatten elke samensteüing die detecteerbaar is door spectroscopische, fo-
tochemische, biochemische, imrauno-chemische, elektrische, optische of chemische
wijzen. Merkers die bruikbaar zijn in de onderhavige uitvinding omvatten biotine voor
30 kleuring met gemerkt streptavidine conjugaat, magnetische korrels (bijvoorbeeld Dy-
nabeads?), fluorescente kleurstoffen (bijvoorbeeld fluoresceïne, Texas rood, rhoda-
mine, groen fluorescent eiwit, versterkt groen fluorescent eiwit en dergeUjke), radio-
actieve merkers (bijvoorbeeld 3H, 1251,35S, l4C, of 32P), enzymen (bijvoorbeeld hydro-
EU 1537 415 Bl
2.MAR.2009 14:43 NED. OCTROOIBUREAU 43703527580 NO.056 P.24
ACCOUNTS
22
lasen, in het bijzonder fosfatasen zoals alkaUsche fosfatase, esterasen en glycosidasen
of oxidoreductasen, in het bijzonder peroxidasen zoals mierikswortelperoxidase en an-
dere die algemeen worden gebruikt in ELISA's), substraten, cofactoren, remmers,
chemiluminescente groepen, chromogene middelen en colorimetrische merkers zoals
5 coUoïdaal goud of gekleurde korrels van glas of plastic (bijvoorbeeld polystyreen, po-
lypropyleen, latex, enzovoort). Octrooien die het gebruik van dergelijke merkers be-
schrijven omvatten Amerikaanse octrooischriftnummers 3.817.837; 3.850.752;
3.939.350; 3.996,345; 4.277.437; 4.275.149; en 4.366.241. Wijzen voor het detecteren
van dergelijke merkers zijn bij de deskundigen in het vakgebied goed bekend. Radio-
10 actieve merkers en chemi-luminescente merkers kunnen aldus bijvoorbeeld worden
gedetecteerd door het gebruik van fotografische film of scintiUatieteUers, fluorescente
merkers kunnen worden gedetecteerd door het gebruik van een fotodetector voor het
detecteren van geëmitteerd Ucht (bijvoorbeeld zoals bij fluorescentie-geactiveerde cels-
ortering). Enzymatische merkers worden kenmerkend gedetecteerd door het verschaf-
15 fen van het enzym met een substraat en het detecteren van het reactieproduct dat wordt
geproduceerd door de werking van het enzym op het substraat en colorimetrische mer-
kers worden gedetecteerd door eenvoudig de gekleurde merker zichtbaar te maken. Een
merker is aldus elke samenstelling die detecteerbaar is door spectroscopische, fotoche-
mische, biochemische, immunochemische, elektrische, optische of chemische wijzen.
20 De merker kan direct of indirect worden gekoppeld aan het gewenste bestanddeel van
de test volgens werkwijzen die in het vakgebied goed bekend zijn. Niet-radioactieve
merkers worden vaak verbonden door indirecte wijzen. Een Ugand molecuul (bijvoor-
beeld biotine) wordt in het algemeen op covalente wijze aan het molecuul verbonden.
Het Ugand bindt vervolgens aan een anti-hgand (bijvoorbeeld streptavidine) molecuul
25 dat ofwel inherent detecteerbaar is of op covalente wijze is gebonden aan een signaal-
genererend systeem, zoals een detecteerbaar enzym, een fluorescente verbinding of een
chemiluminescente verbinding. Een aantal Uganden en anti-Uganden kunnen worden
gebruikt. Wanneer een ligand een natuurUjk anti-ügand heeft, bijvoorbeeld biotine,
thyroxine en Cortisol, kan het in samenhang worden gebruikt met de gemerkte, natuur-
30 hjk voorkomende anti-Uganden. Als alternatief kan elk haptene of antigene verbinding
in combinatie met een antüichaam worden gebruikt, De moleculen kunnen ook direct
worden geconjugeerd aan signaal-genererende verbindingen, bijvoorbeeld door conju-
gatie met een enzym of fluorofoor. Wijzen voor het detecteren van merkers zijn goed
EU 1537 415 Bl
2.MAR.2009 14:44 NED. OCTROOIBUREAU 43703527580 NO.056 P.25
ACCOUNTS
23
bekend bij de deskundigen in het vakgebied. Wanneer de merker een radioactieve mer-
ker is omvatten wijzen voor detectie aldus bijvoorbeeld een scintülatieteUer, fotografi-
sche film zoals bij autoradiografie of storage phosphor imager. Wanneer de merker een
fluorescente merker is kan het worden gedetecteerd door het fluorochroom te exciteren
5 met de juiste golflengte van Ucht en het detecteren van de resulterende fluorescentie.
De fluorescentie kan visueel worden gedetecteerd, door middel van fotografische film,
door het gebruik van elektronische detectoren zoals lading-gekoppelde inrichtingen
(CCD's) of fotomultipüers en dergeUjke. Op overeenkomstige wijze kunnen enzymati-
sche merkers worden gedetecteerd door het verschaffen van de juiste substraten voor
10 het enzym en het detecteren van het resulterende reactieproduct. Eenvoudige colorime-
trische merkers kunnen ook worden gedetecteerd door het waarnemen van de kleur die
is geassocieerd met de merker. Het zal duidelijk zijn dat wanneer paren van fluoroforen
in een test worden gebruikt, het vaak van voorkeur is dat ze verschillende emissiepa-
tronen (golflengten) hebben zodat ze eenvoudig kunnen worden onderscheiden.
15 [0045] Zoals hierin wordt gebruikt betekent de term "nagenoeg identiek" in de
samenhang van het vergeüjken van aminozuursequenties dat de sequenties tenminste
ongeveer 70%, tenminste ongeveer 80% of tenminste ongeveer 90% aminozuurresidu
overeenkomst hebben wanneer wordt vergeleken en gepositioneerd voor maximale
overeenkomst. Een algoritme die geschikt is voor het bepalen van het percentage se-
20 quentie-overeenkomst en sequentiegelijkheid is de FASTA algoritme, die is beschreven
in Pearson, W.R. & Lipman, DJ., 1988, Proc. Natl. Acad. Sei. US., 4. 85: 2444. Zie
ook W.R, Pearson, 1996, Methods Enzymol. 266: 227-258. Parameters die van voor-
keur zijn die bij een FASTA positionering van DNA-sequenties worden gebruikt voor
het berekenen van percentage overeenkomst zijn geoptimaliseerd, BL50 Matrix 15:-5,
25 k-tuple = 2; joining penalty = 40, optimization = 28; gap penalty-12, gap length penalty
=-2; en width =16.
[0046] Zoals hierin wordt gebruikt verwijzen de termen "sandwich", "sandwich
ELISA", "sandwich diagnostiek" en "vangende ELISA" aUe naar het concept van het
detecteren van een biologisch polypeptide met twee verschillende testmiddelen. Een
30 PDZ-eiwit zou bijvoorbeeld direct of indirect kunnen worden verbonden aan een vaste
drager. Testmonster zou over het oppervlak kunnen worden gebracht en het PDZ-eiwit
zou aan de verwante PL-eiwit(ten) ervan kunnen binden. Een gemerkt antüichaam of
EU 1537 415 Bl
2.MAR.2009 14:44 NED. OCTROOIBUREAU 43703527580 NO.056 P.26
ACCOUNTS
24
alternatief detectiereagens zou vervolgens kunnen worden gebruikt om te bepalen of
een specifiek PL-eiwit het PDZ-eiwit heeft gebonden.
[0047] Met "vaste fase drager" of "drager" wordt elke drager bedoeld die in staat is
polypeptide, antigeen of antiUchaam te binden. Goed bekende houders of dragers om-
5 vatten glas, polystyreen, polypropyleen, polyethyleen, dextran, nylon, amylasen, na-
tuurUjke en gemodificeerde ceUulosen, Polyacrylamiden, agarose en megnatiet De aard
van de drager kan ofwel in enige mate oplosbaar of onoplosbaar zijn voor het doel van
de onderhavige uitvinding. Het dragermateriaal kan in wezen elke mogeUjke structurele
configuratie hebben zolang het gekoppelde molecuul in staat is te binden aan een PDZ-
10 domein polypeptide of een E6 antüichaam. De drager configuratie kan aldus sferisch,
zoals een korrel of cyündrisch zoals het binnenste oppervlak van een testbuis of het
externe oppervlak van een staafje zijn. Als alternatief kan het oppervlak vlak zijn zoals
een vel, kweekplaat, teststrip, enzovoort. De deskundigen in het vakgebied zullen vele
andere geschikte dragers voor het binden van antüichaam, peptide of antigeen weten of
15 kunnen deze vaststeüen door routine experimenten.
[0048] Zoals hierin wordt gebruikt worden de termen "testverbinding" of "testmid-
del" onderling uitwisselbaar gebruikt en verwijzen naar een gegadigd middel dat acti-
viteit kan hebben van een versterker/agonist of remmer/antagonist, bijvoorbeeld het
remmen of versterken van een interactie zoals PDZ-PL binding. De gegadigde midde-
20 len of testverbindingen kunnen elk van een grote verscheidenheid van verbindingen
zijn, zowel natuurUjk voorkomend en synthetisch, organisch en anorganisch en waar-
onder polymeren (bijvoorbeeld oügopeptiden, Polypeptiden, oUgonucleotiden en po-
lynucleotiden), kleine moleculen, antüichamen (zoals hierin ruim is gedefinieerd), sui-
kers, vetzuren, nucleotiden en nucleotide-analoga, analogen van natuurlijk voorko-
25 mende structuren (bijvoorbeeld peptide nabootsers, nucleïnezuur analoga en dergeUjke)
en talrijke andere verbindingen. Bij bepaalde uitvoeringsvormen worden de testmidde-
len bereid van een diversiteit van bibüotheken zoals wülekeurige of combinatoriële
peptide of niet-peptide bibüotheken. Veel bibüotheken zijn in het vakgebied bekend die
kunnen worden gebruikt bijvoorbeeld chemisch gesynthetiseerde bibüotheken, recom-
30 binante (bijvoorbeeld faag-display bibüotheken) en in vitro translatie-gebaseerde bi-
büotheken. Voorbeelden van chemisch gesynthetiseerde bibüotheken zijn beschreven
in Fodor et al., 1991, Science 251: 767-773; Houghten et al., 1991, Nature 354: 84-86;
Lam et al. , 1991, Nature 354; 82-84; Medynski, 1994, Bio/Technology 12: 709-710;
EU 1537 415 Bl
2.MAR.2009 14:45 NED. OCTROOIBUREAU 43703527580 NO.056 P.27
ACCOUNTS
25
GaUop et al., 1994, J. Medicinal Chemistry 37 (9): 1233- 1.251; Ohlmeyer et al., 1993,
Proc. Natl. Acad. Sei. USA 90: 10922-10926; Erb et al., 1994, Proc. Naü. Acad. Sei.
USA 91: 11422-11426; Houghten et al., 1992, Biotechniques 13: 412; Jayawickreme et
al., 1994, Proc. Natl. Acad Sei. USA 91: 1614-1618; Salmon et al., 1993, Proc. Natl.
5 Acad. Sei. USA 90: 11708-11712; PCT PubUcatienummer WO 93/20242; en Brenner
en Lerner, 1992, Proc. Natl. Acad. Sei. USA 89: 5381-5383. Voorbeelden van faag-
display bibüotheken zijn beschreven in Scott en Smith, 1990, Science 249: 386-390;
Devlin et al., 1990, Science, 249: 404-406; Christian, R. B., et al? 1992, J. Mol. Biol.
227: 711-718); Lenstra, 1992, J: Immunol. Meth. 152; 149-157; Kay et al., 1993, Gene
10 128: 59-65; en PCT Pubücatie nummer WO 94/18318 gedateerd 18 augustus, 1994. In
vitro translatie-gebaseerde bibüotheken omvatten maar zijn niet beperkt tot die welke
zijn beschreven in PCT Publicatie nummer WO 91/05058 gedateerd 18 april, 1991; en
Mattheakis et al., 1994, Proc. Natl. Acad. Sei. USA 91: 9022-9026. Bij wijze van voor-
beelden van niet-peptide bibliotheken kan een benzodiazepine bibUotheek (zie bijvoor-
15 beeld Bunin et al., 1994, Proc. Natl. Acad, Sei. USA 91; 4708-4712) worden aangepast
voor gebruik. Peptoïde bibüotheken (Simon et al., 1992, Proc. Natl. Acad. Sei. USA
89: 9367-9371) kunnen ook worden gebruikt Een ander voorbeeld van een bibliotheek
die kan worden gebruikt waarbij de amide fünctionaüteiten in peptiden zijn geperme-
thyleerd voor het genereren van een chemisch getransformeerde combinatoriële bi-
20 bliotheek is beschreven door Ostresh et al. (1994, Proc. Natl. Acad. Sei. USA 91:
11138-11142).
[0049] De term "specifieke binding" verwijst naar binding tussen twee moleculen,
bijvoorbeeld een Ugand en een receptor, die wordt gekarakteriseerd door het vermogen
van een molecuul (Ugand) om te associëren met een ander specifiek molecuul (recep-
25 tor) zelfs in de aanwezigheid van vele andere diverse moleculen d.w.z, om preferentiële
binding te tonen van één molecuul voor een andere in een heterogeen mengsel van
moleculen. Specifieke binding van een Ugand aan een receptor wordt ook getoond door
verlaagde binding van een detecteerbaar gemerkt Ugand aan de receptor in de aanwe-
zigheid van overmaat niet-gemerkt Ugand (d.w.z. een test op competitie van binding).
30 [0050] Bij sommige uitvoeringsvormen kunnen "proteasoom remmers", dw.z.
remmers van de proteasoom, worden gebruikt Deze remmers, waaronder carboben-
zoxyl-leucinyl-leuciny-1 norvalinal n (MG 115) of CBZ-LLL kunnen worden verkre-
gen van bedrijven die chemicaüën leveren (bijvoorbeeld Sigma). Zoals het voor een
EU 1537 415 Bl
2.MAR.2009 14:46 NED. OCTROOIBUREAU 43703527580 NO.056 P.28
ACCOUNTS
26
deskundige in het vakgebied duideUjk zal zijn, zijn proteasoom remmers niet protease
remmers.
[0051] Zoals hierin wordt gebruikt heeft een 'Verscheidenheid" van PDZ eiwitten
(of overeenkomstige PDZ-domeinen of PDZ fusiepolypeptiden) de gebruikeüjke bete-
5 kenis ervan. In sommige uitvoeringsvormen is de verscheidenheid tenminste 5 en vaak
tenminste 25 of tenminste 40 of tenminste 60 verschülende PDZ-eiwitten. In sommige
uitvoeringsvormen wordt de verscheidenheid geselecteerd uit de opsomming van PDZ-
polypeptiden die zijn opgesomd in Tabel 2. In sommige uitvoeringsvormen zijn de ver-
scheidenheid van verschülende PDZ-eiwitten van (d.w.z. tot expressie gebracht in) een
10 specifiek gespecificeerd weefsel of een specifieke klasse of soort van cel. In sommige
uitvoeringsvormen vertegenwoordigt de verscheidenheid van verschülende PDZ-ei-
witten een aanzienüjke fractie (bijvoorbeeld kenmerkend tenminste 50%, meer vaak
tenminste 80%) van alle van de PDZ-eiwitten waarvan bekend is of waarvan wordt
vermoed dat ze tot expressie worden gebracht in het weefsel of cel(len), bijvoorbeeld
15 aUe van de PDZ-eiwitten waarvan bekend is dat ze aanwezig zijn in lymfocyten of he-
matopoëtische ceUen. In sommige uitvoeringsvormen in de verscheidenheid tenminste
50%, gewoonUjk tenminste 80%, tenminste 90% of aUe van de PDZ-eiwitten die hierin
zijn beschreven als tot expressie te worden gebracht in een specifieke cel,
[0052] Wanneer wordt verwezen naar PL-peptiden (of de overeenkomstige eiwit-
20 ten, bijvoorbeeld die welke overeenkomen met die welke zijn opgesomd in Tabel 3 of
elders hierin) kan een "verscheidenheid" verwijzen naar tenminste 5, tenminste 10 en
vaak tenminste 16 PL's zoals die welke hierin specifiek zijn opgesomd, of naar de klas-
sen en percentages die hierboven uiteengezet zijn voor PDZ-domeinen.
25 n. Overzicht
[0053] De onderhavige uitvinders hebben een groot aantal interacties geïdentifi-
ceerd tussen PDZ-eiwitten en PL-eiwitten die een aanzienüjke rol kunnen spelen bij de
biologische functie van een verscheidenheid van fysiologische systemen. Zoals hierin
30 wordt gebruikt verwijst de term "biologische functie" in de samenhang van een cel naar
een detecteerbare biologische activiteit die op normale wijze door een cel wordt uitge-
voerd, bijvoorbeeld een fenotypische verandering zoals celproliferatie (bijvoorbeeld
kanker), celactivatie, cytokine-afgifte, degranulatie, tyrosinefosforylatie, ion (bijvoor-
EU 1537 415 Bl
2.MAR.2009 14:46 NED. OCTROOIBUREAU 43703527580 NO.056 P.29
ACCOUNTS
27
beeld calcium) flux, metabole activiteit apoptose, veranderingen van genexpressie,
handhaving van structuur van de cel, celmigratie, hechting aan een substraat, signaal-
transductie, cel-cel interacties en andere die hierin zijn beschreven of in het vakgebied
bekend zijn.
5 [0054] Omdat de interacties eiwitten behelzen die zijn betrokken bij diverse
fysiologische systemen (zie het deel van de Achtergrond hierboven) kunnen de werk-
wijzen die hierin worden verschaft worden gebruikt voor het op brede of selectieve
wijze diagnosticeren van onjuiste ceUulaire fenotypen of pathogène infecties. Werkwij-
zen zijn hierin ook beschreven voor het bepalen of vertebrate biologische monsters pa-
10 thogene organismen bevatten door het gebruik van PDZ-PL-eiwit interacties.
[0055] Zoals hieronder in sterk detaü zal worden beschreven is het gebruik van
PDZ-PL interacties voor diagnostische doelen handelbaar voor een aantal van ver-
schillende testvormen en is niet bedoeld te worden beperkt door de beschrijving hierin.
Diagnostische testen zouden kunnen worden geformateerd voor ELISA-testen als een
15 dipstick test zoals die welke wordt gebruikt voor zwangerschapstesten, als een film test
die kan worden geïncubeerd met testmonster, als een test op een objectglaasje waar het
monster op kan worden geplaatst of andere dergeUjke mediums. DergeUjke vormen zijn
in het vakgebied goed bekend en zijn beschreven in Amerikaanse octrooischriftnum-
mers 6.180.417,4.703.017, 5.591.645
20
IU. PDZ-eiwit en PL-eiwit interacties
[0056] Tabel 4 geeft een opsomming van PDZ-eiwitten en PL-eiwitten die de
onderhavige uitvinders hebben geïdentificeerd als te binden aan elkaar. Elke bladzijde
25 van Tabel 4 omvat vier kolommen. De kolommen in elk deel zijn van links naar rechts
genummerd zodanig dat de meest linker kolom in elk deel kolom 1 is en de meest
rechter kolom in elk deel kolom 4 is. De eerste kolom is elk deel is aldus gemerkt
"HPV stam" en geeft een opsomming van de verscheidene E6-eiwitten die de PDZ-ü-
gand sequenties (PL's) die werden onderzocht bevatten (getoond tussen haakjes). Deze
30 kolom geeft een opsomming van C-eindstandige vier aminozuren die overeenkomen
met het carboxy-eindstandige uiteinde van een peptide van 20 aminozuren die bij deze
studie van binding is gebruikt AUe Uganden zijn gebiotinyleerd aan het amino-uitemde
en gedeeltetijke sequenties zijn getoond in Tabel 3.
EU 1537 415 Bl
2.MAR.2009 14:47 NED. OCTROOIBUREAU 43703527580 NO.056 P.30
ACCOUNTS
28
[0057] Het PDZ-eiwit (of eiwitten) dat of die interactie vertonen met E6 - PL
peptiden van HPV zijn opgesomd in de tweede kolom die "PDZ-bindende partner" is
gemerkt Deze kolom verschaft de gen naam voor het PDZ-deel van de GST-PDZ fusie
die interactie vertoont met het PDZ-ügand aan de linkerkant Voor PDZ-domein be-
5 vattende eiwitten met meerdere domeinen is het domeinnummer aan de rechterkant van
de PDZ opgesomd (d.w.z. in kolom 4 die is gemerkt "PDZ-domein") en geeft het PDZ-
domeinnummer aan wanneer het is genummerd van het amino-uiteinde naar het car-
boxy-uiteinde. Deze tabel geeft aUeen een opsomming van interacties van een sterkere
aard, bijvoorbeeld die welke een "4" of "5" classificatie leveren in de "G-test". "Classi-
10 ficatie" is een maat voor het niveau van binding. In het bijzonder verschaft het een
waarde van absorptie bij 450 nm die de hoeveelheid van PL-peptide gebonden aan het
PDZ-domein aangeeft. De volgende nummerieke waarden hebben de volgende beteke-
nissen: "1" - A450nm 0-1; "2" - AtSOnm 1-2; "3" - A450nm 2-3; "4" - A450nm 3-4; "5" -
A450nm van 4 meer dan 2x herhaald; "0" - Aasonm 0, d.w.z. niet gevonden interactie te
15 vertonen.
[0058] De derde en vierde kolommen van Tabel 4 zijn overwegend een herhaling
van de kolommen 1 en 2 met verschülende E6 PL's getest en de PDZ's die erdoor wor-
den gebonden bij hogere affiniteit
[0059] Verdere informatie met betrekking tot deze PL-eiwitten en PDZ-eiwitten
20 wordt verschaft in TabeUen 2 en 3 en Voorbeelden 4 en 5. In het bijzonder verschaft
Tabel 3 een opsomming van de gedeelteüjke aminozuursequenties van peptiden die bij
de testen zijn gebruikt. Wanneer ze zijn genummerd van links naar rechts verschaft de
eerste kolom die is gemerkt "HPV-stam" het nummer van de HPV-stam die is gebruikt
om te verwijzen naar het E6-eiwit van die stam. De kolom gemerkt "C-eindstandige
25 sequentie van E6" verschaft de voorspelde sequentie van de carboxy-eindstandige 10
aminozuren van het E6-eiwit De derde kolom gemerkt "PL ja/nee" geeft aan of de E6-
PL sequentie sequentie-elementen bevat waarvan wordt voorspeld dat ze binden aan
PDZ-domeinen. De laatste kolom gemerkt "oncogeen" geeft aan dat deze HPV-stam
bekend is baarmoederhalskanker te veroorzaken zoals wordt bepaald door het National
30 Cancer Institute (NCI, 2001).
[0060] Voorbeeld 5 geeft een opsomming van representatieve sequenties van PDZ-
domeinen die zijn gekloneerd in een vector (PGEX-3X vector) voor productie van
GST-PDZ fusie-eiwitten (Pharmacia). Een uitgebreide opsomming van PDZ-domeinen
EU 1537 415 Bl
2.MAR.2009 14:51 NED. OCTROOIBUREAU 43703527580 NO.057 P.2
ACCOUNTS
29
gekloneerd in pGEX vectoren voor productie van GST-PDZ fusie-eiwitten is opgesomd
in Amerikaans octrooischriftnummer 09/724553.
[0061] Zoals in detaü hierin is beschreven zijn de PDZ-eiwitten die zijn opgesomd
in Tabel 2 natuurUjk voorkomende eiwitten die een PDZ-domein bevatten. AUeen sig-
5 nificante interacties zijn getoond in deze tabel. De onderhavige uitvinding heeft aldus
in het bijzonder betrekking op de detectie van interacties tussen een PDZ-eiwit en PL-
eiwit. Op een overeenkomstige wijze kunnen PDZ-domeinen die andere pathogenen
binden worden gebruikt voor het diagnosticeren van infectie, Aanvullende voorbeelden
van PL-eiwitten van pathogenen die geschikt zijn voor diagnostische toepassingen zijn
10 opgenomen in Tabel 8, maar zijn niet bedoeld de beschermingsomvang van de onder-
havige beschrijving te beperken,
[0062] In een andere uitvoeringsvorm van de uitvinding kunnen ceüulaire
abnormaliteiten of ziekten worden gediagnosticeerd door de detectie van onevenwich-
tigheden in de expressieniveaus van PL-eiwitten. Door het gebruik van ofwel het PL-
15 eiwit of het PDZ-eiwit in een test die wordt verkregen van de "A-test" of "-test" kan
men de niveaus van eiwitexpressie van bindende partners in een normale of abnormale
cel bepalen. Verschülen in niveaus van eiwitexpressie zijn gecorreleerd met een aantal
ziekten.
[0063] In de onderhavige uitvinding wordt een PDZ-eiwit gebruikt voor het
20 diagnosticeren van de aanwezigheid van een PL-eiwit van een humaan papülomavirus.
IV. Testen voor detectie van PDZ-eiwitten of PDZ-Ligand eiwitten (PL-eiwitten)
[0064] Twee complementaire testen, genaamd "A" en "G" werden ontwikkeld
25 voor het detecteren van binding tussen een PDZ-domein polypeptide en gegadigd PDZ-
ligand. Bij elk van de twee verschülende testen wordt binding tussen een peptide dat
een sequentie heeft die overeenkomt met het C-uiteinde van een eiwit waarvan wordt
aangenomen dat het bindt aan één of meer PDZ-domeinen (d.w.z. een gegadigd PL-
peptide) en een PDZ-domein polypeptide (kenmerkend een fusie-eiwit dat een PDZ-
30 domein bevat) gedetecteerd. Bij de "A" test wordt het gegadigde PL-peptide geïmmo-
büiseerd en binding van een oplosbaar PDZ-domein polypeptide aan het geïmmobüi-
seerde peptide wordt gedetecteerd (de "A" test is genoemd naar het feit dat in één uit-
voeringsvorm een avidine oppervlak wordt gebruikt voor het immobüiseren van het
EU 1537 415 Bl
2.MAR.2009 14=51 NED. OCTROOIBUREAU 43703527580 NO.057 P.3
ACCOUNTS
30
peptide). Bij de "G" test wordt het PDZ-domein polypeptide geïmmobüiseerd en bin-
ding van een oplosbaar PL-peptide wordt gedetecteerd (De "G" test is genoemd naar
het feit dat in één uitvoeringsvorm een GST-bindend oppervlak is gebruikt voor het
immobüiseren van het PDZ-domein polypeptide). Voorkeursuitvoeringsvormen van
deze testen zijn hieronder in detaü beschreven, Het zal echter duideUjk zijn voor de
deskundige in het vakgebied dat deze testen op talrijke wijzen kunnen worden gemodi-
ficeerd terwijl ze bruikbaar Wijven voor het doel van de onderhavige uitvinding.
10
A. Productie van fusie-eiwitten die PDZ-domeinen bevatten
[0065] GST-PDZ-domein fusie-eiwitten werden bereid voor gebruik in de testen
van de uitvinding. PCR-producten die voor PDZ coderende domeinen bevatten (zoals
hierboven is beschreven) werden gesubkloneerd in een expressievector om expressie
van fusie-eiwitten die een PDZ-domein en een heteroloog domein (d.w.z. een gluta-
15 hion-S transferase sequentie "GST") bevatten, mogeUjk te maken. PCR-producten
(d.w.z. DNA-fiagmenten) die voor PDZ-domein coderend DNA vertegenwoordigen
werden geëxtraheerd van agarosegels door het gebruik van het "Sephaglas" gelextractie
systeem (Pharmacia) volgens de aanbevelingen van de fabrikant.
[0066] Zoals hierboven is opgemerkt werden PCR-primers ontworpen om
20 endonucléase restrictieplaatsen te omvatten om ligatie van PCR-fragmenten in een
GST-gen fusievector (pGEX-3X; Pharmacia, GenBank inschrijvingsnummer
XXU13852) in het leeskader met de voor glutahion-S transferase coderende sequentie
mogeUjk te maken. Deze vector bevat een IPTG induceerbare lacZ promoter. De
pGEX-3X vector werd geüneariseerd door het gebruik van BamHI en EcóBI of in
25 sommige gevaUen EcóSl of Smal en gedefosforyleerd. Voor de meeste benaderings-
wijzen voor klonering werd dubbele digestie met BamHI en EcoRI uitgevoerd zodat de
uiteinden van de PCR-fragmenten om te kloneren BamHI en EcoRI waren. In sommige
gevaUen waren restrictie-endonuclease combinaties die werden gebruikt BglII en
EcoRI, BamHI en Mfel of aüeen EcoRI, aUeen Smal of aUeen BamHI. Wanneer meer
30 dan één PDZ-domein werd gekloneerd vertegenwoordigt het DN A-deel dat wordt ge-
kloneerd de PDZ-domeinen en het cDNA deel dat tussen twee afzonderiijke domeinen
is gelokaliseerd. Precieze locaties van gekloneerde fragmenten die in de testen zijn ge-
bruikt zijn aangegeven in Amerikaanse octrooi-aanvraag (60/360061). DNA ünker se-
EU 1 537 415 Bl
2.MAR.2009 14:52 NED. OCTROOIBUREAU 43703527580 NO.057 P.4
ACCOUNTS
31
quenties tussen het GST deel en het PDZ-domein bevattende DNA-deel variëren enigs-
zins afhankeUjk van welke van de hierboven beschreven kloneringsplaatsen en benade-
ringswijzen werden gebruikt. Als een gevolg varieert de aminozuursequentie van het
GST-PDZ fusie-eiwit in het ünkergebied tussen GST en het PDZ-domein. Eiwitünker
5 sequenties die overeenkomen met verschülende kloneringsplaatsen/benaderingswijzen
zijn hieronder getoond. Linkersequenties (vector DNA gecodeerd) zijn vetgedrukt, van
PDZ-domein bevattende gen afkomstige sequenties zijn scheefgedrukt
1) GST-Banüïï/BamHI-PDZ domein insert
10 Gly-He-PDZ domein insert
2) GST-BsmtWBgUI-PDZ domein insert
Gly-De-PDZ domein insert
15 3) GST-EcoKUEcoRI-PDZ domein insert
Gly-De-Pro-Gly-Asn-PDZ domein insert
4) GST-SmaUSmaJ-PDZ domein insert
Gly-Ue-Pro-fDZ domein insert
20
[0067] Het voor PDZ coderende PCR-fragment en gelineariseerde pGEX-3X vec-
tor werden met ethanol geprecipiteerd en geresuspendeerd in 10 ul standaard Ugatiebuf-
fer. Ligatie werd gedurende 4-10 uur bij 7°C uitgevoerd door het gebruik van T4 DNA-
ügase, Het zal duideUjk zijn dat sommige van de resulterende constructen zeer korte
25 linkersequenties omvatten en dat, wanneer meerdere PDZ-domeinen werden geklo-
neerd, de constructen enig DNA gelokaliseerd tussen afzonderiijke PDZ-domeinen
omvatten.
[0068] De ügatieproducten werden getransformeerd in E. coü bacteriële stammen
DH5 alfa of BL-21, Kolonies werden gescreend op de aanwezigheid en de identiteit
30 van het gekloneerde PDZ-domein bevattende DNA alsook op juiste fusie met het voor
glutathion S-transferase coderende DNA-deel door PCR en door sequentie-analyse.
Positieve klonen werden getest in testen op kleine schaal op expressie van het
EU 1537 415 Bl
2.MAR.2009 14:52 NED. OCTROOIBUREAU 43703527580 NO.057 P.5
ACCOUNTS
32
GST/PDZ domein fusie-eiwit en indien ze deze tot expressie brengen werden deze klo-
nen daaropvolgend voor bereiding van GST/PDZ fusie-eiwit op grote schaal gekweekt
[0069] GST-PDZ-domein fusie-eiwit werd tot overexpressie gebracht volgend op
de toevoeging van IPTG aan het kweekmedium en gezuiverd Gedetaüleerde werkwijze
5 van expressie en zuivering van fusie-eiwit op kleine schaal en grote schaal zijn be-
schreven in "GST Gene Fusion System" (tweede editie, herziening 2; gepubüceerd
door Pharmacia). In het kort werd een kleine kweek (50 ml) die een bacteriële stam
(DH5a, BL21 of JM109) met het fusie-eiwit construct bevat gedurende de nacht ge-
kweekt in 2xYT medium bij 37°C met de juiste antibioticum selectie (100 ng/ml ampi-
10 cüline; ook bekend als 2xYT-amp). De kweek die gedurende de nacht was gekweekt
werd gegoten in een verse bereiding van 2xYT-amp (kenmerkend 1 üter) en gekweekt
tot de optische dichtheid (OD) van de kweek tussen 0,5 en 0,9 was (bij benadering 2,5
uur). IPTG (isopropyl ß-D-thiogalactopyranoside) werd toegevoegd tot een uiteinde-
üjke concentratie van 1,0 mM voor het induceren van productie van GST fusie-eiwit en
15 de kweek werd gedurende een aanvuUende 1 uur gekweekt. AUe volgende stappen,
waaronder centrifugatie, werden uitgevoerd op ijs of bij 4°C. Bacteriën werden verza-
meld door centrifugatie (4500 x g) en geresuspendeerd in buffer A- (50 mM Tris, pH
8,0, 50 mM dextrose, 1 mM EDTA, 200 uM fenylmethylsulfonyl-fluoride). Een geüjk
volume van buffer A+ (Buffer A-, 4 mg/ml lysozym) werd toegevoegd en gedurende 3
20 minuten op ijs geïncubeerd voor het lyseren van bacteriën of totdat lysis begon. Een
geüjk volume van buffer B (10 mM Tris, pH 8,0, 50 mM KCl, 1 mM EDTA. 0,5%
Tween-20, 0,5% NP40 (ook bekend als IGEPAL CA-630), 200 uM fenylmethylsulfo-
nylfluoride) werd toegevoegd en gedurende een aanvuUende 20 minuten op ijs geïncu-
beerd. Het bacteriële ceUysaat werd gecentrifugeerd (x20.000 g) en supernatant werd
25 over een kolom gebracht die 20 ml Sépharose CL-4B (Pharmacia) "prekolom korrels"
bevat d.w.z. sépharose korrels zonder geconjugeerd glutahion die daarvoor zijn gewas-
sen met 3 bedvolumes van PBS. De doorloop werd toegevoegd aan glutathion Sépha-
rose 4B (Pharmacia, cat no. 17-0765-01) die daarvoor waren gezwoUen (gerehydra-
teerd) in IX fosfaat-gebufferde zoutoplossing (PBS) en geïncubeerd terwijl het draait
30 gedurende 30 minuten - 1 uur, De slurrie van supernatant-Sepharose werd gegoten in
een kolom en gewassen met tenminste 20 bedvolumes van IX PBS. GST fusie-eiwit
werd van het glutathion sépharose geëlueerd door het toevoegen van hoeveelheden van
0,5 - 1,0 ml van 5 mM glutathion en als afzonderiijke fracties verzameld. Concentraties
EU 1537 415 Bl
2.MAR.2009 14:53
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.057
P.6
33
van fracties werden bepaald door het aflezen van de absorptie bij 280 nm en het bere-
kenen van de concentratie door het gebruik van de absorptie en extinctiecoëfficiënt Die
fracties die de hoogste concentratie van fusie-eiwit bevatten werden samengevoegd en
een geüjk volume van 70% glycerol werd toegevoegd tot een uiteindeüjke concentratie
van 35% glycerol. Fusie-eiwitten werden getest op grootte en kwaüteit door SDS-gel-
elektroforese (PAGE) zoals is beschreven in "Sambrook". Hoeveelheden van fusie-ei-
witten werden opgeslagen bij min 80°C en bij min 20°C.
10
Tabel 2: PDZ-domeinen die zijn gebruikt bij testen van de uitvinding
Bwnr^f
»»«strand
ifiZ______
AF8
wpc
ttPQ
WO
W8
UMpwtota
«*Xt-1
tflteraiHbs
BSSÏ!___
MrapTtto.1
msrnctths
dotant
taepfiM
PrnMIrt
OLsi
^fp^pP-ZMBM gj
430«
127111451
tZTBtWl
»ui ii nt i»
127K4S1I
12761491
S373QM
1SSS12SS
284791
9047231
3847231
iMaaS«m*wr^"ffwt
SflPlD
SfM3M| 1 *DWU£AHKDW1Sra<USQ«emBPPtMHU^^
TOMFa5UWlBgtfWOH^aM>PTlUJ5VaW___________________________
Li^t^VBtaoHwaammiHMm^____________________
IJWHQIPlICBayOlMIHTFKO^^
sisafiRicnKprowMEmNXP'mmisiaAef^

LGMVAVWDALO/mKï^tQimAWKSiWTaDO^
IRHffU^t«fro«CMUMU£PâDVaMDGR3TCSMT
tVEWfcSQaAPffliamKßtraHHGEPLVr^^
5FWQEAictvmawcruavwwNs3

HS^QMUHTEWDllJCaCPiaSblSÜIHreSGFr
to
*|i|' « MP' "ll^n
*rt?UWHUWMEBfiP(»»ruBGDElMaPlUGAV»ï^
SlPV^(OHRYV|CLM)HHAnRN3aVf«.-tVR»ÖCW.CQ
11
EUl 537415 Bl
2.MAR.2009 14:53
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.057
P.7
34
Tabel 2: PDZ-domeinen die zijn gebruikt bij testen van de uitvinding
2SHÖSBML
$Ü?.fiSË ?Pa ü*?*"» 0»«a»ftaSTCarti»L
. &3J3

2047331
es)<OB8MBi>argDWffl<rao<EcraF\nissuwjti^^
CAKU\VODRIUVNQQSBNf^«W>lvnifiBAQLS>mRllPO£ßt
12
MiopMrHi
intaiscBAgr.
ZWZSi
S LSr>"fTKÎPQfcroYFTVBItfia<]a*lCSrora
ta
WrojïrtliKl
28(7231
ÖSÉË»
TPvAeLflRlMA\n(CHC*nPU«J<CV10OßOlMR
14
4VMMHMWBM«----------------------------__--------------------------------------------
QAWM1
1238377!
15
CMU>14
W120«SU
llflgWTWLAfPBBm^SVKaQrfcT«^
td
BASK
3Wf«
rromtyoFojamres^nuaweuwc^^
^»0^-rvF^q^LJtEHRQSmyrVPSYWTQS____________________________
17
BWKnBff-
9990781 1
!£QIOIMLRIVaLDSPLSl£IMmNCQHFVSQV^^
18
»SIBOt 1
SSÈÉL
BR)!XVTV£KOSNETKirefaaY«P<aWQn*^
19
?MUM«
1S7G9SB! 1>
!»PQF,ltfNUflî^lqUMMaN8FVH»^^
0J.O1
47W1Î f
(WrNOroADVEVKmÊfi^SQWîFaïAQOTCNPMIISOT^
21
DLBf
4W»tfi 2
]UKSPW&£*8!A>5<nfl3NaHrJH3D^
?LBt
47WK
lUresslrGutfNMîGRQt^iroFiuaaF^^
9mtu*vmrW»Wmm(1*___............... ,,__________
23
EK.02
12738963


9UB2
T273BSQ3
6V\rEIKLFKÖPraLOFSE««3VafWHIPQOMmr(moiDOCM^^^
Mwytvsug^ATigE^VAtwrecvvvuowtg^______________________
29
sua
UTMSfc
IWA\R3WSmWAa)4CâSrati3FNIVGaEDGTO^
llJ^C»0U«3AaHeQAMAU<G^Q1>mWQVWaD______________________
ao
BLOS
96S04S1
atPWEEPRHVKMQKGSimeiSlUSC^^^
BiMiai^TC(»ftBi.CTPQ0O7TTOAQYNPW^iay^>ffi«iL-m
27
OLG!
36S0451
attACawiocns»HvvFMOc$aiELßVK^^
28
DLâ&apfflM
MltMII
14847140
3ai>l^TO«HEM1S«UAf^^
MfftanOTOIFKVVTVStffinfrlgg__________________________________
29
DIGt. apfla»
imrlintg
ABQW303 1
msvavECLapgQV)i
i^aiuiaA'juiii'xni,^^;.^-:
ao
DVL1
22010« 1
UWIVnJMERMEfaa&NaQSH&R^^
>ftrVNPCTM^Bnlk\W\AJgt\«al1^9LTVAtCeW_________'_. | ,
31
DV12
22BIG0!
jjinvnj4NEicy>jRûi8f«»sNEFetMewasi^^ 32
3VL3
«aw« 1
iRvn^H0<vwi0»9VGeffiNB)coo^vKa&n>i»BQAVM aa
aiwi
2S57144
rTO^lAflPQfWI^lVefWBflSQPlA^^
w»m<igAtffwwBCTafl^TV»aspiKwwaWLV_____________________
34
mata.
SB1«ej 1 fiFMOS«Vtfl£GRMWGWlLaSG»JWFlS^^
35
ERBIN
iKDPEtfi^soovQORffltPfiv'aoaQifvn^vai^GPAS^
3d
EU 1537 415 Bl
2.MAR.2009 14:54
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.057
P.8
35
Tabel 2: PDZ-domeinen die zijn gebruikt bij testen van de uitvinding
»oi» Wam»
Qlqrto* EPS» 3CTMffw*LtaBtfte<^a»giMd
»w«»

3220011

37
BtedDig
922001!
msnumBPSGitapuiiisBKBii^^
ÎCX0HGOWGABtJemiG\W.VmWQ*FmHS&
38
FUB0M1
10443381
Qtmaaxr^n£namiaijBt$ise&maaici^^
39
SU112ifl
.114393«
m.SMPlS*IBLPKrBEQ\Jimm!EBXEC^
40
ULMZ42Û
BC8H2S4:

41
sjm«
104942«
(MYCÛETVKJVTOEKAflDIPlGAYVWJBIffiSVI
srE)Roq>WRffmM»MHtPrtTFVtgi«Miitf»i>»
PU2O07B
7018031
WWWKOqOVlOSVWICVODMfESIN
43
FLB1M7
1043783«
^SQASOHFSmVKC^AGHÏLTU^aRBVAGa^^
30tyLKIWQIiSTC^THACfrVHM»^ '
FU9134Q
AKDSS911

46
FUS2N9
AKZUttafit
LABEEB&VKimvn4RlEJ>U^TOOa3EQrriSN^^
JQIPVEPKT^ffilQllAQSt^ArrFWPSSKEETPSMSa______________________
4e
4B3DHK
i/vuMK&srmouvsaai&KJ^pft/SNui
47
smp«
4S39QM 2 itSSMPOTV&mjiSCEISOTCFVraBaW
SPWMVPJMRUOTWAe^SIUWClWBftAUgVDVa^^ _____
48
SMPT
4338)83 3
iVATOGHluVl^AiaPiMBUSmiJlSK^^
49
4S98893 4
rcrrcv%a.Tw»vrofoiai^BevrATCTU6PPus^EA05w^^
«0
3*2Pf
4539093

&l
wa*i
45390« e
.TKGOUtEKTOUHtGimMNSSSUtCKP «8
W3PTpVEtaKmYKDSaMEDPa*SVÄDG^^
as»
ÖTIFSU
Entwi»
336KHM
ÏRöCETRaALPflQGOGRltfFEVOAHBVTrl^^
J»SLHP£AAAfltlftaAPKWCV7Vl«»DESQro»
54
Bwwlrw
?flli^Wff^^
cesorw
*KAi«0Rav\rwi«stemjBm»K^E»tfr<i^^
WEVNOaMraOT1«WK**BLWtMn^
99
S2ESË-
10435357
!&SVlA)CSUjIKSNeGdViaFGt£I^^
1049007
l»RETVJUPD3AOaiflR5IRaR3I,5VVHIlVaRGW^
WSWWVTACWCyWRPTKQOSia________________________________________
sr
ttJMQA
|flB2Z.
7022001
£DTOVVFTVU£ft©PSGiÄ*6UDGMHT>fUMP<X1rta
RttJEa^aUSumftAVTXJ^SaO^^________________
4TFM3
AYtMOSSI
LTETODK^KDWKKHFtGiraWITOTr«LVDElK*£MPaFPEV^
fnvu
iNADL
NAM.
KM».
AUHB444
wtorusnaeeuLi
'AAQSSatStBHSN.
60
Z3701«
MrOieTtOlEAIiSTGCm8WAlfl&QNtfacvo^^
^lNKTP^X3^«lSHeK^A^lalot^^csu^^vAHEI^wr»<ssTS3SE
«1
samt«!
TQMVEEV^NOf^CUSFGN'OmasaWVmiVTVOlAOlirMRlOTOOHlUQO^

EU 1537 415 Bl
2.MAR.2009 14:55
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.057
P.9
36
Tabel 2: PDZ-domeinen die zijn gebruikt bij testen van de uitvinding
Sana Wanrt_ _tg y Aj
Jëag)>og;
Vv^iivWkKiM&tàwsKTO
ja
NA»
237014«
TOflOAaQWRMaiPKrilUflVEVOOTX>MHV188fVBgqFWm^t^^
IJO|^tVg»qtRREA\«W<BfpW^mwaa»tLrODEAS
64
INADL
297014t
L6SJ»EVKwa,VKDCKßl£rslinVÖDFUJmBVr^^
NAffi.
237014«
WO^HWOPWWErjT?I^VSUSrawVOrjTWKRlJ^
«AUCrG0MLQr5GVDUat4SHSeAVEAa<^^
iritiK.
smut
l^&HJffilXKOWaWlSUQNKORSRMHPVVGÄPEa
^LYCIU^W£*llCTAPSJCVKLWTJWEOAWO»W439___________________
«7
iwa
237014t
»ATCPJVPGOEWBISSI«ÏRSaU3LSSVlïaKOTFUWr^
68
KMMM47
14Cfll7£
MLTtLRQTIJK»*rai«BCBaJ3rrm<^EW^
BVAtflOAEHI^VEAUTOCnAVOMr^^
KMAW47
1468871
FnjlQRKVABARSSlQLOt:SSOSI(GSrPyRAanMnP/SniAEOaAAHRACmiQV
70
KUA0147
1468871
3 iwapwi^PiiJGKmißiia^^
«UM0147
H8W7Ï
4 RELcaoiwpastbaeiRBBMtSKiieivRtlvtDBQ^
72
KIAMB09
1 »HCpnmtsssKWsroRAffartfvaDsiHri^^
73
WA»«
78P2BE 1 lUKJAAKAiWRLMmJKPSRSftPUmUâSS&QBFSi^^
74
KWAoate
OBKtSi
iPPAPRKlrHffiRS!WSR»WGSmVkM&^
SAAPRlERWtfttoRBCSKEStU.TrllWPVPaWC
75
«WMJwa
222482C
LKKRTJWKDSQAUÄUCWBOWjrrmiQJanAFm^^
78
KMA0390
2ZZ4TQC
aWC^OKOPHGrWIvgaaRMLXWSVWPaiAAMICAflMOSflORflKVMg^ 77
4UEWÎO3K3QAWM-T1X0BB__________________________
tewAooaa
7082881
&.voitcwiaKD0wem.TV84OMWFVQSM?}a^^
78
KMA0449
SWB«rrU«WStCaLGFHVmMrwU3VEPTOTAWQAßU^
*<B»wwuHravTVKwnppwp_________________________________________
78
OAOM»
14742ISC 1
BCWVA\AfIt.TJ10QMlPUIin»ny>on^
80
OAMaSfl
3043»1 t
rtYOTHMtrKRRfisKamvroN^
UMB6MOABWa»tt?aKrreBiag|^^
81
OAAfiWI
30(3811 1
IÖ3SUWWMS8QKKK^LJWKVYM00S0^^
82
OAAQ813
8327031 1
BYSWTLTSPtg'WCTiafiQCWffl^^
OAAÖ7«
127341«
i5TajacÄWtauwvaoKrmBSGiacAFmft«K®aA^
.Q^T1^EV^1i£SKPaH3VT^WSWn<M)0lP_________________________
04
KKA0B07
^OfiMttf'ttnNfcfteMWBFrlltaRVYMOBB^^
*QtroUTHWatPVmyKTEW13J^G>ffW^______________
SS
«AAÖ8S6
««ZW
rNOSKBWHMMAKA^______________________
BS
KMAO0OS
asAHLEUffltANKPseaiGOTÄsrrraaHv^^
KOTw<aArouo<ivHttiraifPfl<^ __________________
87
WAA0BS7
45SOTT7
IlTOTUPVRHTVMDKimaOTYGWaesmTWAV^^
^gABuawg^voajae>a>staHy>morpmw»K8^ .

GAACS73
458S8»! 1
3UWPfTlOHSQKKY0FTLR«RUVM0EnnVVSVHWVWH^^
80
EU 1 537 415 Bl
2.MAR.2009 14:56
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.057
P. 10
37
Tabel 2: PDZ-domeinen die zijn gebruikt bij testen van de uitvinding
oi « Acefc POM SwiflJM» totri tt BSTConrinirt
'SM ID
cAAitöa
QâQBTOSmviMRDSGSlGntilfiSIVSWNKDQS^^
so
ÖAA1KS
6880S2I
Q0L§3REElS£5VDLYm/INBOOm^TVCYl^^
E^awllOlyolg^^wEEAv>uxT^Elw^F$UJARpa.gLo _
61
QKAtSOe
8330421
RSFQYVltyCtaûûAlWaFaKOfaEHCO^TVr^^
Hggyy<?Sl«fflAUUKGSmTtJttJVWCTtfWPVS
88
OAA1222
essoBic
!L£WJBU?»VEI£l<ngOSÜS3llBWSV^rifta£Xlg^
SS
OAA1284
633130t
KDV*WYW»OaTVWW<B8ÜI&U^V6lW^

OAAlSfl»
72*31«

?5
OAA1416
7243211
aw>qsafaawQB^aatRi»um.vAiKAittaKiF______________________
<J*A1526
681716t
PDaraPOEtfRUrSlJlMKAHEaUäf'sata^^
37
OAAT528
861716t
LO£3DEKttMLVtA0GRSLQVTOGQAEmamKi\rIPHï^^
SB
0AA1H8
58171«
ATTSQAHWSQPCEB(COreCHRQPUTWnaRQCBAHMCO^
XWA1820
100473«
aRWARVgrvCTBMBrevsQaMw^oaKffioapvwg^
wpFEwncvsiMüauqcfti^rxySFt^M^^
100
OAA1634
psttjapvtvRAauocsiwsroFTnB^^
101
QAMBH
VXXKVH
*SSl^Sä1^VTO>U^KÖFGFAUUCP^^
B»IVOWLT^OWEW13qywa*mflnjUlRGOPPBFTriCrAKM
102
ttAA.1834
1000344
LYQ3KPPUWmJSNPRTTiWP^>?KPI*m<nUïVT^
K)SiyK5Aßrn^A*JEKÖ0HlÄÄAmAK^^
1 >ffWW!gTgg!K0PeS0SO8J!<eWHELT_________________..........,........,-.....?,,,......
103
KVA1634
1fiM7344
»AlPttBFlrtW\fUJRIl0«5GW3|^^^
:waAVNQosMM^ivou>ffl*g^_______________
104
SAA1834
10047341 S
IPKG7^mRMX}KZrtW«G|Ur1U11AB3GnUKI»3^
inHTRMgUWCSCrWKWXUJtPOTOlPDHOLA_____________________
105
I0AA171B
1287889
rrWEUKKTOBTLGlTOG0TDiaJSiO>HVSNlRP^^
mifWDE81UWIVaEgWlB<EY_____________________________________
108
<UWM7T»
rants i
.IUJVSI
lLYK6GN8FGroJ«3aAMIä>GtflCSttPLVLTV>^^
IPiWaASflATAUUROOSHBAiJWg«^^_______________________
107
QAA1710
12B7BH
fKTVAKASOPlMVQVKTPGSALQlSUTTfSUWiCSVini^
108
0AA1719
1287093 3
\TmtsmEmaüsvmjwt^^
103
OAA1710
12B7S89 4
Erei«uAioMnB»yireD»M^________________
11D
OAA1710
laoToas s
icrrrcaOTOTvattcroGi^msGHa^
nt
«AA1719
T2S7B8Î e


JM
1273426t 1
wÄTWjVAapAPWGPRmsGronmwnwAEi^^
113
JMpKtfa&t
310BOBJ 1
SNtf3V^VGPAfWI2mQQQrattM^TOSuaBaßr9W
«M«W^WOTKOOTQ9U<Mnfl1^_________________________________
114
Matt
4687481 1
aVEMSKLVCGHCT«>TtAfl7MïflnJ>DSJ<33HlJHfT^ 4«
3m*CPf»OeGTeMSHTVtM3GVDlH3C«|SmffC^^
TTiTrlTTfffi i ? oi ni nr tT^Tm ? ^n miimu<.....----- rih in if
jmiq
1609382 1
^«VrmiSnPATT^RRQFSVSVESACÖJYATtVlQVKEV^^
110
EU 1 537 415 Bl
2.MAR.2009 14:57
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.057
P.11
38
Tabel 2: PDZ-domeinen die zijn gebruikt bij testen van de uitvinding
Bcna Nun»
UM-Rtt,
Aki
.?.
mm
man
ttAOK
BSNT1
WNT1
«HT3
«INT»
G] nei
** ? SW^fe^«SnS2B^
1089021
usai 11
3370*03
3370997 2
3370BB7 3
MSVTLRapaPTOQflllvaRWWLTTSIWi^^
OWgACTWKeCHgHLUSWBlge----------------,----------------------------------------
tfCYKTODEBHBTVVlJEVNFf'IBlAAKK^RE^
MTNISllMAWPEBaiA ?
BC012477 1
E
IS
OHOtffOTSWHEOTWRCPaGSl^V^
EGPRuat^EUijproG>mv5<api^eAftjBviö^KgA\mi«v^
PSaXeKFIHnOJWSERQFGFrWGOOEPriBI£j01KaVlBGP*Ai«yauETraJVI
KNVOAI
lT(a>0jrrvMrvKQPftraFQn«wSPe66e<H9/KöWDSPWR
'AM^I<EOTnBAU>MWQQSG»«3lT!AQRQDCT^^
tolVQATWWlNia^WlUJITI^^ ......---------------
3SZH24 1 5S4CI6rV7TCROKOEIUWVflVW<3WCmU*1tVtlAiM^
tt3R^mPUmMSIgMUg4QS^^----------------------------------
2625024] 2 IRCPPVTTVUIWMSWVOLÖIiSNKWOaOSUM^
«WEtCMHIIuBNWaB^____________________________
316980%
3108ttt
1BS78!
LS^OrWÄEVKUa(WßeOLQVALVC8(»raSUFTA
mTAWCT^VOU»tAAqWtfl»CTKSÔTCVTi^^ _____________
117
118
IW
120
120
1Z7
128
LVHCPtvnwtHHPH/tfffiâL&cvmfflmim^^
RKV«LiCB!ocroeFMsrr^
^HSVDt3U>l«MlffiroiMISUCWH»Wq
128
130
WPPS
pwPD*vww\mmicr«Ha<uGyTnw©m
iffi0fY0q^MaEujiMB?8v^^------------------------------------
131
WUPPI
2104784
LOffVqeiOEaSVAHRDORlXETO
^GQAUWaTTTH(3D)iaLQK<M<DTtfQUVVWas»<n.V
132
SWPP1
2104784
2 PVWWQWWEnELVNDGKÄGraSSQ^TXlVnrtCni^^
183
2104704
3 DESE*7!WrELTXNVeOi«1T»<m30IQ«JW^
___*>QT>axM»miQttftviMJwre^^ ------------------------
13«
WOT"!
2TO4784
4 LXVBWVAKVa<FSBfi«^9lE*fVSM4flRSVlFGG^
138
WUPP1
2104764 S
2104784
m»xs^ei&B38)KSMSim£r^
13ft
tfUPPI
IAXf»IBa£ttTV8ANKDaLailMttMQ43A^^
iwmrrwPAiiHige_____________________
137
8UPP1
2104764
je/mapmweüMi^aKsißißMoosv^^
mKWarjRwgtfpgwPlwDASHEOAV^M^^^
1S8
MUPP1
2104764 8
LTesu4MtnEHQ>i8QU!i4iAGNKD*$^^
130
MUPP1
2104784 9 LSSFIOMlHLaPKSOQGUSMSI^Dn^OViPCSUeaiVAA^
ue
MUPP1
210479«
LPQCimiEISjaafmftGtsaiGaSD^
BIOU^THDB*J!>IWlCrTWW^UVWDgAy^^__________________________
141
MUPPf
21047
I7W 11 KEÊEVCOTVnEUQ
I ÎWWGEDVRXATQl
,T1EU»a^KeUStSSVGKRr^^
BWAAUW»LanmJg<rt3MIICAOPn48__________________

EU 1537 415 Bl
2.MAR.2009 14:58
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.057
P. 12
39
Tabel 2: PDZ-domeinen die zijn gebruikt bij testen van de uitvinding
SHJSBsa.
g»sLÉse 2S2 SffiaaaBüasËaSEÊasssA.
SSjE
Wl
2104761
12
Lf}^U«VCMiaXQPTDSU98tM3QW?pU}OVPIFIAMI«
/tW?STSTKGWrr>m»V>fetJWSQ9IEMC^ , , ?
143
ifiUFFf
2104784
13 jBsvcaat^BwixJumtoiQ&faB^
____!AVNGQ81J0VTHCgAVAnJCR11(CTIVTl*VU1
144
«?OU»
1CS03EK
«TBEiVüSitawsgioFgiJ&greNPrtW
MB^BrVHSlWEMXBMSP*^^_____________________
143
MbDLO
1CB8J9W 2 ITUKQPIttijäF8tA6QIGN0NIPcaM16CyRKU^^
140
»toouo
1Q803S2C 3
UMtesrt^st^rJOGBXSESFvrsMJVSSPASiJSiâ^^
'A0YTV»£EYaRFE3WIHDlRËffiWMN^^
147
HMfftJUnll
AMSUe« 1
SMSI^U:PV«Lia<D8£auaSflQM0AQAQM^
148
K081
642321
QPMUIGMllJTOttaa^VKaiVSKPPW^
^V°l-S»gB«gVU«aA8CT1VViaTO>
149
NntiPDZ
7ZS»177 1
.mtàPOZ
7226171
SAJ^ESOimSVKVBWPAGRiOySVROOSfirt^ 1S0
jwrr^gtmggTTMasavmTSaau^^ ?
3 »SBreSEDGVR!UV%YTraDrciJ8Fr4]*?^^
«1
fawSSMJW
1621242
<r»OWEWDIWWniO«T»aCTlfflRKIMM.raSKAKE^
*rjTPAEAGg»<eN0VIISlNga8VV&W^
152
»«?m>Blwtinïi
AKBS6821
»OSaTSöQf<WWPSE3lSjm.VQQSeT1^Vr«0CMrWDO^
153
itaimbBlnd&ip
AKB56829
MKSSPEEOLGlKWRKVTCWïWITnwUJQGV/mWeOlfT^
lklNSKPU>y^PE«AAHUQAS6r4JlWWy5ROVftQRaPa<B8
194
isäü
AK050323
___? ^AQQASHRBKOSJ»nrVJBWPOCVffiWDGRlKT>Qt3
165
Pimmw
itviJCKDMJwiTAasusreiw^^
180
EM»
7023821
lJ.tS^ntLT1«0P8&U3F»8VOQTDGffiVVSNBS«7^^
u8v>iaoouotti>«apawBiJiWAG^^^
187
aasr
1Z7333B7

158
wwa
603701»
WQMVXLVEW»»CGPUW\M>F&WWïeR1tQ1J^^
»>WlWProt«WPWWSdAQ>flMH<QAMItT^^ ___________________
ISO
PAR»
mmt
9KWJN1QU0(QTHM.<B^rreRDVT1GsaAPiyVKNilJ>RQ^ 100
3^<CLVSIfl5agBVVSiiJtgn{MHCTV31^vroaEO»
PAR»
soars«
nV09»EFUT«VPUWS«»ACnjSVSWKEn«nSKEK^
LWWOQt»VNgE8LUÎKTWOI»MEnjWBMSreO^^
101
PARA
2613011
UPCTHW*VMJtiO1t»BRP(jl5iTO0aUffî^
162
RARO GAMMA
1393711« 1
iroDLVPf^RRVftiffiHrjCaanXtfyiRDGASV^^
«as|3T<sqjwwo^Ae^iE«AaitTux»ffp^^
103
POX-73
9031 on
FtsHioKEVRURuipeei^LSvASQtE3:acoijn3»ojHtooawa^
104
P0Ï-T3
S03107C
^<^MNUiHK^VWUta8^^^_______________
1B&
P0&78
5031571
^^SiSSIZ^^M^ääW^SSSSSä^l^SStSt.
PDZK1
29M18I .1
LTS1TNpRECKUKQC«iWC1Tl«EKPTECWLVRVVEKCÏ*WEKAaL<a»0RVU
PDZK1
zBMieq 2 ^ixvLVMEQGSvap^uavaoïoazvvHTDrriHiQVAMtAO^^
?ASMSEVVecVK>^OSf^tli.VPHftlUW<l^lvm>
502X1
2844184 3 iOfWlErASUQUPHQ^RJVEttMKaSltCT^
KMNm.WAvwaiSMmcHDBüVEi«j^^
16»
EU 1537 415 Bl
2.MAR.2009 14:59
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.057
P. 13
40
Tabel 2: PDZ-domeinen die zijn gebruikt bij testen van de uitvinding
Senf Hm« j Glat
»02Ä1
20441
INDITEEVDHIC'WXnLAjeGeäSTOJ^U^^
iew<cvNvi]rjEPwioA«gw88eiq4vTU^
rtoedtojagrCBiwWM»
SflBlO
17»
171
NOC«
4678411
1 ?i\tPQi«ima?/<QtessmxoM^
?I8T
MOV6PtreCUUIJ(£Dn83U$âiTSOKDN3VPItISHNPQ^
WaVNUtMI0*ravnUSO0jqi3BgW^^__________________
1T2
««Niyyi
3flt18
jAsa
PSD05
1478483
»HTlJWEHîAeLGFSUVQGAD?NKVn^
17*
1478488
r/l£*T<«W1l£iaAa«U3rai£QÛI?BUtGDr
174
3318693
\EtSan£MStßQUWSWXmxvmS!D^^
175
331BWS
WlfflUUaWlEKMMejAiKGPMSUa^^
ttQlQP<OiAVMgvmJeflMW03»»^^
176)
3318639
Wnpj&PIffiMNIBasmanWQSEDQEGIHSni^^
»MMDttPttSMIOAAlAUOWOai^^______________________
177
TtU
1799» 1
UHnFDeDGXFSRlUCaQVDGXNPlWSJIJ^^
äHIWQVVMIICAgRggHSniaAtWWW -------------------------------------_
178
PTM-4
180747} 1 suaa>oeroKronwicoaroû!K^^
FHPM
S1S03E
?TPU
6168»
1 PB*BTLVffl*ltP4>CV«UraiOSa^
,?? SWM8VSiJ«3VS«MAAiaifl«W^DmVISQP^^ ------------------
2 aOtFEVELA»a»i8LOtBVTSgtfWTSWKai3^^^
MSwgtEBATWtOftvmwMraqWHl 11 nwwwpwor_____________----------
179
180
181
^TPM
siBoat
lEBnnevKiiiaissjsusreFSRBJNUPi^^
182
PIPU1
P7B.1
SWBSS,
4 ELEVÖirTUKBiKAStGlTVTWSMDWCa^rVHDtflQnPAKaD^^
«mJMnnTWNlUt»Alfo1Vm.Vtt^^
183
61603t
*OPHUJPDni.TCNK£ElOm«SGHB^YDVW
184
W812
3280911
^PSPPRVRSVEVANQRAGPrOPflAOUA«^^
awvKio»^eDWKLioKC8sviJowtAËgt<B»gaia
las
RG83
160447»
J55SWYKamPRQKD{3FOFTlC<asa»Vl!NlC»VOfi^
WP>flWWCmMqinSC**i^^__________________
180
Il II'
HtopT\tHn-«Jw
142704« 1
gaLVPCKMtTuaafflBaug^^__________
187
Sarin
27360« 1
MÏ©<WraaS©f«3SaRRyieVMMJ1£P«HJ*HflLRlS»S^^
*MRAQIJRSKIP¥iUK33»WH*^^
188
Sankt
1 EaCIWLQWClOWgBFCaFVUU3AKM7TPt6BPnn^
___i*ttH*u^wgfflMcw»<Ra^^
18S
100
Stank 3
1 SOY^PDKtfAVtOWFUIHEGrOFVlJlQAtOKbl Ma^rPtPAmAlfllflfiSVBWSQWA
Sfofloont
169828981 1 IVUmiE&U*^aniK08U3K3aPliffilWEKÏ©6^^
wi
iipi
20473271 1 W^VRQEaCNOfWUlGßKGRWÄFTO^^
192
srpi
9047323

193
194
snAc«
68B&Q71
P&UFtfSHijCiaSRGiattJtUlKVDQOUTOlVOA^
^GtfmHICAHOWlOWaa»)^^________________________
SITAC-16
8868071
=TOfnVTWB«DSMGMVr^tW(GW»aW»K8^^
»>ggMaiATAQMtAm.TÎIPÏW1fEMMËFV
105
SSTH1P
702545t 1
JCEKTVLLOiaXDSeQPOlMJtQAXAQTPieEFtPT^^
100
EU 1537 415 Bl
2.MAR.2009 14:59
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.057
P. 14
41
Tabel 2; PDZ-domeinen die zijn gebruikt bij testen van de uitvinding
an» »ten»
OjjpyAçc* Ppa aegWTOwfimeHpqgrCanatrut«
SB»
îTNTTJHW
S7DSB83
[BXM9Bflwmona»mKMf(mSfe^^
107
SYW7HWN
«BRPITOnr^OasTOAttnimSXRSr^^
108
îyntroptlnl
"Pft"
1145727
3RW*vTVRKHW^Gß&aQRENW^r^
189
SyMnpMin
478701
KWKaeW60l£l8lMSGRENRMpaj^
209
SüRtmpHß
98071«
EWTOGBmVrlRRQWWÎFOLOKôeiMÎ^^
203
SynbapNn
mwti> 2
0607161
^QafajRfnVTUtRQPVr_äUKailG3<3S£ltKVPV^^
202

3283111
RQETKEVEVTK?DAljGLTTt8NQA3YAnKra^^
MRKYËV*KhriJmj'KSQPFnmVQPI<RAF
203
ITAM1
4fl07SC(
?U«E>C8OTWWrrt3ras8VEE0ttRftLY\^^
»OWW8g|iiaCTRJ6QPSt<aLWCr»PB^
204
f»M2
Q9127D3
>1LNVyUV<^TKn3$VCWÖWWAaV0ER<l^
mtl^reiaflÜ<BMSNU^K8m^
205
TBK
2S136&1
!iRVBH»JWGm4WF$IOeQlDaOT6öW^
aiq0Wii)taVM3>i<l»OTm^___________
208
RP8
2S13O0S
«K&VSUFlC3E8ttin.TriOKaAaY^^
4YBVAHUXBUN«MnPUiq.TgRK__________________________________
207
was
2813097 1
-isHWweu>i<TOS3uaï*MyraQwe5»»spmsw!pac^
3WSVEOEWHBW«>imiiqWtiB6ViaLWWriPKM._____________......
208
Jnp43
BM1 tsta
2613011
ifiMQKR_V]WUCaEL(MljGI8iX_GKBNHOTl^^
^LPt^lW^VOAlJWAOKiaAljmMWEaCTTW_____________________
200
30CSSS! 1
HFaCENC«aQl£KH^PLCWVVES6WCClf^VILWWM^^ 210
frUtota
PPVTTWJI«POU<Vaii^SVai«ttCSUfl«WlA£af^^
ieVOaHW<T*ffi^AMFRil.TQQEM58_______________________
211
KM
»MgpHTvni<aAPGriiaratiuBc<«OHPKpo^
212
hm
20283»
mwNfpnwvKsamiiEBmajmM^
?«?aWHHfcMBMIWIMtn^^............______________________
213
KM
mm
3 IIUAKLVKFiraD&VaU&AGBNDVQRFtf^
_ «"^v»-ttM»VWPre^ffffiq^^________:_____________
214
tO-2
12734761
mwM&mmmMsmaaui^^ _______
215
SO*
12734703
W4JW?HAWiEïr_Jl_asïB«A_»rt^^
210
HM
12734763
*M^TKWWRFKKÖDSVOILRtAeta<nv<H^
nomvR?AVLYUgwwaivTiiAoafWDw_______________________
217
KM
10662884 1 IPBM83JVVÇQKTATU3^RTCFGIM&B^
WtVMyHaySM£NAT8AFA»OJUffCra^
218
KW
4Q09209C 2
l»VQ*W*fK5\lVKflRDS£EHSrK^
210
CO-9
lo&azsot 3
TOYSPtjnWRRAGKSlGUUAOTMUVQD^rSGVW^
220
[0070] De aminozuursequenties die worden verschaft in Tabel 2 hierboven kunnen
aminozuren bevatten die afkomstig zijn van een fusie-eiwit, bijvoorbeeld GST. PDZ-
domein sequenties die van specifiek belang zijn kunnen tot 20 aminozuren korter zijn
(bijvoorbeeld 5, 8, 10, 12 of 15 aminozuren korter) dan de sequentie die is verschaft in
Tabel 2. Een sequentie kan bijvoorbeeld tot 3, 6, 9 of 12 aminozuren van het C-uit-
einde, N-uiteinde of beide uiteinden zijn ingekort
EU 1 537 415 Bl
2.MAR.2009 15:00 NED. OCTROOIBUREAU 43703527580 NO.057 P.15
ACCOUNTS
42
B. Identificatie van gegadigde PL-eiwitten en synthese van peptiden
[0071] Bepaalde PDZ-domeinen worden gebonden door de C-eindstandige resi-
duen van PDZ-bindende eiwitten. Voor het identificeren van PL-eiwitten werden de C-
5 eindstandige residuen van sequenties visueel onderzocht op sequenties waarvan men
zou voorspellen dat ze binden aan PDZ-domein bevattende eiwitten (zie bijvoorbeeld
Doyle et al., 1996, Cell 85, 1067; Songyang et al., 1997, Science 275, 73), waaronder
de aanvullende consensus voor PL's die zijn geïdentificeerd bij de Arbor Vita Corpo-
ration (Amerikaanse octrooi-aanvraag 60/360061). Tabel 3 geeft een opsomming van
10 enige van deze eiwitten en verschaft overeenkomstige C-eindstandige sequenties.
[0072] Synthetische peptiden met gedefinieerde sequentie (bijvoorbeeld die welke
overeenkomen met de carboxyl-uiteinden van de aangegeven eiwitten) kunnen worden
gesynthetiseerd door elke standaard hars-gebaseerde werkwijze (zie bijvoorbeeld Ame-
rikaans octrooischriftnummer 4.108.846; zie ook Caruthers et al,, 1980, Nucleic Acids
15 Res. Symp. Ser., 215-223; Horn et al., 1980, Nucleic Acids Res. Symp. Ser., 225-232;
Roberge, et al., 1995, Science 269: 202). De peptiden die zijn gebruikt in de testen die
hierin zijn beschreven werden bereid door de FMOC (zie bijvoorbeeld Guy en Fields,
1997, Meth. Enz. 289: 67-83; Wellings en Atherton, 1997, Meth. Enz. 289: 44-67). In
sommige gevallen (bijvoorbeeld voor gebruik in de A- en G-testen van de uitvinding),
20 werden peptiden gemerkt met biotine aan het amino-uiteinde door reactie met een vier-
voudige ovennaat van biotinemethylester in dimethylsulfoxide met een katalytische
hoeveelheid van base. De peptiden werden van de hars gesplitst door het gebruik van
een halogenide-bevattend zuur (bijvoorbeeld trifluorazijnzuur) in de aanwezigheid van
geschikte anti-oxidanten (bijvoorbeeld ethaandithiol) en in overmaat oplosmiddel ge-
25 vriesdroogd.
[0073] Volgend op vriesdrogen kunnen peptiden opnieuw worden opgelost en
gezuiverd door vloeistofchromatografie met groot scheidend vermogen (HPLC) met
omgekeerde fase. Eén geschikt HPLC oplosmiddel systeem behelst een Vydac C-18
semi-preparatieve kolom die bij 5 ml per minuut loopt met toenemende hoeveelheden
30 van acetonitrol plus 0,1% trifluorazijnzuur in een basis oplosmiddel van water plus
0,1% trifluorazijnzuur. Na HPLC zuivering werd de identiteit van de peptiden beves-
tigd door MALDI kation wijze massaspectrometrie.
EU 1537 415 Bl
2.MAR.2009 15:01 NED. OCTROOIBUREAU 43703527580 NO.057 P.16
ACCOUNTS
43
C. Detectie van PDZ-PL interacties
[0074] De onderhavige uitvinders waren gedeeltelijk in staat om de interacties die
zijn samengevat in Tabel 4 te identificeren door het ontwikkelen van nieuwe scree-
5 ningstesten met hoge doorvoer die in meer detail hieronder zijn beschreven. Verschei-
dene andere testvormen die in het vakgebied bekend zijn kunnen worden gebruikt voor
het selecteren van liganden die op specifieke reactief zijn met een specifiek eiwit. Vaste
fase ELISA immuuntesten, immuunprecipitatie, Biacore en Western blot testen kunnen
bijvoorbeeld worden gebruikt voor het identificeren van peptiden die op specifieke
10 wijze binden aan PDZ-domein Polypeptiden. Zoals hierboven is beschreven werden
twee verschillende complementaire testen ontwikkeld voor het detecteren van PDZ-PL
interacties. Bij elk wordt één bindende partner van een PDZ-PL paar geïmmobiliseerd
en het vermogen van de tweede bindende partner om te binden wordt bepaald. Deze
testen die hieronder zijn beschreven, kunnen eenvoudig worden gebruikt voor het
15 screenen van honderden tot duizenden mogelijke PDZ-ligand interacties in een paar
uur. Deze testen kunnen aldus worden gebruikt voor het identificeren van nog meer
nieuwe PDZ-PL interacties in cellen. In aanvulling kunnen ze worden gebruikt voor het
identificeren van antagonisten van PDZ-PL interacties (zie hieronder).
[0075] Bij verscheidene uitvoeringsvormen worden fusie-eiwitten in de testen en
20 inrichtingen van de uitvinding gebruikt, Werkwijzen voor het construeren en tot ex-
pressie brengen van fusie-eiwitten zijn goed bekend. Fusie-eiwitten zijn in het alge-
meen beschreven in Ausubel et al., hierboven, Kroll et al.s 1993, DNA Cell. Biol. 12:
441 en Imai et al., 1997, Cell 91: 521-30. Gewoonlijk omvat het fusie-eiwit een domein
voor het bewerkstelligen van immobilisatie van het eiwit aan een vast substraat ("een
25 immobilisatiedomein"). Het immobilisatiedomein omvat vaak een epitoopmerker
(dw.z. een sequentie die wordt herkent door een antilichaam, kenmerkend een mono-
klonaal antilichaam) zoals polyhistidine (Bush et al, 1991, R Biol Chem 266: 13811-
14), SEAP (Berger et al, 1988, Gene 66: 1-10), of Ml en M2 flag (zie bijvoorbeeld
Amerikaanse octrooischriftnummers 5.011.912; 4.851.341; 4.703.004; 4.782.137). In
30 een uitvoeringsvorm is het immobilisatiedomein een voor GST coderend gebied. Het
zal duidelijk zijn dat, in aanvulling op het PDZ-domein en de specifieke residuen die
worden gebonden door een geïmmobiliseerd antilichaam, proteïne A, of op andere
wijze in contact worden gebracht met het oppervlak, het eiwit (bijvoorbeeld fusie-ei-
EU 1537 415 Bl
2.MAR.2009 15:01 NED. OCTROOIBUREAU 43703527580 NO.057 P.17
ACCOUNTS
44
wit) aanvullende residuen zal bevatten. In sommige uitvoeringsvormen zijn deze resi-
duen van nature geassocieerd met het PDZ-domein (d.w,z. in een specifiek PDZ-do-
mein) maar ze kunnen residuen omvatten van synthetische (bijvoorbeeld poly(alanine))
of heterologe oorsprong (bijvoorbeeld spacers van bijvoorbeeld tussen 10 en 300 resi-
5 duen).
[0076] PDZ-domein bevattend polypeptide dat wordt gebruikt in de werkwijzen
van de uitvinding (bijvoorbeeld PDZ fusie-eiwitten van de uitvinding) worden kenmer-
kend gemaakt door (1) het construeren van een vector (bijvoorbeeld plasmide, faag,
faagmide) die een polynucleotidesequentie omvat die codeert voor het gewenste poly-
10 peptide, (2) het introduceren van de vector in een geschikt expressiesysteem (bijvoor-
beeld prokaryoot, zoogdierlijk of celvrij expressiesysteem), (3) het tot expressie bren-
gen van het fusie-eiwit en (4) eventueel het zuiveren van het fusie-eiwit.
[0077] (1) In één uitvoeringsvorm omvat de expressie van het eiwit het insereren
van de coderende sequentie in een geschikte expressievector (d.w.z. een vector die de
15 noodzakelijke elementen bevat voor de transcriptie en translatie van de geïnsereerde
coderende sequentie die nodig is voor het expressiesysteem dat wordt gebruikt, bij-
voorbeeld regulerende elementen waaronder versterkers, promoters, transcriptie-termi-
nators, oorsprong van replicatie, een geschikt initiatiecodon (bijvoorbeeld methionine),
open leeskader en translationeel regulerende signalen (bijvoorbeeld een ribosoom bin-
20 dingsplaats, een terminatiecodon en een polyädenylatiesequentie). AfhankeUjk van het
vectorsysteem en de gastheer die wordt gebruikt kan elk aantal van geschikte transcrip-
tie en translatie-elementen, waaronder constitutieve en induceerbare promoters, worden
gebruikt.
[0078] De coderende sequentie van het fusie-eiwit omvat een PDZ-domein en een
25 immobilisatiedomein zoals elders hierin is beschreven. Polynucleotiden die coderen
voor de aminozuursequentie voor elk domein kunnen worden verkregen van een ver-
scheidenheid van wijzen die in het vakgebied bekend zijn; kenmerkend worden de po-
lynucleotiden verkregen door PCR amplificatie van gekloneerde plasmiden, cDNA-
bibliotheken en cDNA gegenereerd door omgekeerde transcriptie van RNA, door het
30 gebruik van primers die zijn ontworpen op basis van sequenties die zijn bepaald door
de laborant of meer vaak, publiekelijk beschikbaar zijn (bijvoorbeeld door middel van
GenBank). De primers omvatten linkergebieden (bijvoorbeeld sequenties die restrictie-
plaatsen omvatten) voor het bewerkstelligen van klonering en manipulatie van produc-
EU 1537 415 Bl
2.MAR.2009 15:02 NED. OCTROOIBUREAU 43703527580 NO.057 P.18
ACCOUNTS
45
tie van het fusieconstruct De polynucleotiden die overeenkomen met de PDZ en im-
mobilisatiegebieden worden in het leeskader verbonden voor het produceren van de
voor het fusie-eiwit coderende sequentie.
[0079] De fusie-eiwitten van de uitvinding kunnen tot expressie worden gebracht
5 als uitgescheiden eiwitten (bijvoorbeeld door het opnemen van het voor de signaalse-
quentie coderende DNA in het fusiegen; zie bijvoorbeeld Lui et al, 1993, PNAS USA,
90: 8957-61) of als niet-uitgescheiden eiwitten.
[0080] In sommige uitvoeringsvormen worden de PDZ-bevattende eiwitten of PL-
polypeptiden geïmmobiliseerd aan een vast oppervlak. Het substraat waar aan het poly-
10 peptide wordt gebonden kan in elk van een verscheidenheid van vormen zijn, bijvoor-
beeld een microtiterplaat, een testbuis, een dipstick, een microcentrifugebuis, een kor-
rel, een te centrifugeren buis, een permeabel of semi-permeabel membraan en derge-
lijke. Geschikte materialen omvatten glas, plastic (bijvoorbeeld polyethyleen, PVC,
polypropyleen, polystyreen en dergeUjke), eiwit, papier, koolhydraat, lipide monolayer
15 of ondersteunde lipide bilayer, films en andere vaste dragers. Andere materialen die
kunnen worden gebruikt omvatten keramiek, metalen, metalloïden, semigeleidende
materialen, cement en dergelijke.
[0081] In sommige uitvoeringsvormen zijn de PDZ en/of PL fusie-eiwitten
georganiseerd als een array. De term "array" zoals hierin wordt gebruikt verwijst naar
20 een geordende rangschikking van geïmmobiliseerde fusie-eiwitten waarin specifieke
verschillende fusie-eiwitten (d.w.z. die verschillende PDZ-domeinen hebben) zijn ge-
lokaliseerd op verschillende vooraf bepaalde plaatsen op het substraat Omdat de loca-
tie van specifieke fusie-eiwitten op de array bekend is, kan binding aan die locatie wor-
den gecorreleerd met binding aan het PDZ-domein die op die locatie is gesitueerd. Im-
25 mobilisatie van fiisie-eiwitten op korrels (afzonderlijk of in groepen) is een andere spe-
cifiek bruikbare benaderingswijze. In één uitvoeringsvorm worden afzonderlijke fusie-
eiwitten geïmmobüiseerd op korrels. In één uitvoeringsvorm worden mengsels van te
onderscheiden korrels gebruikt. Te onderscheiden korrels zijn korrels die van elkaar
kunnen worden gescheiden op de basis van een eigenschap zoals grootte, magnetische
30 eigenschap, kleur (bijvoorbeeld door het gebruik van FACS) of affiniteitsmerker (bij-
voorbeeld een korrel die is bekleed met proteïne A kan worden gescheiden van een
korrel die niet is bekleed met proteïne A door het gebruik van IgG affiniteitswerkwij-
zen. Binding van een specifiek PDZ-domein kan worden bepaald.
EU 1537 415 Bl
2.MAR.2009 15:02 NED. OCTROOIBUREAU 43703527580 NO.057 P.19
ACCOUNTS
46
[0082] Werkwijzen voor het immobiliseren van eiwitten zijn bekend en omvatten
covalente en niet-covalente werkwijzen. Eén geschikte werkwijze voor immobilisatie is
antilichaam-bemiddelde immobilisatie. Volgens deze werkwijze wordt een antilichaam
dat specifiek is voor de sequentie van een "immobilisatie-domein" van het PDZ-do-
5 mein-bevattende eiwit zelf geïmmobiliseerd op het substraat (bijvoorbeeld door ad-
sorptie). Eén voordeel van deze benaderingswijze is dat een enkel antilichaam kan
worden gehecht aan het substraat en worden gebruikt voor het immobiliseren van een
aantal Polypeptiden (die hetzelfde immobilisatiedomein delen). Een immobilisatie-do-
mein dat bijvoorbeeld bestaat uit poly-histidine (Bush et al, 1991, J Biol Chem 266:
10 13811-14) kan worden gebonden door een anti-histidine monoklonaal antilichaam (R &.
D Systems, Minneapolis, MN); een immobilisatiedomein dat bestaat uit uitgescheiden
alkalische fosfatase ("SEAP") (Berger et al, 1988, Gene 66: 1-10) kan worden gebon-
den door anti-SEAP (Sigma Chemical Company, St Louis, MO); een immobilisatie-
domein dat bestaat uit een FLAG-epitoop kan worden gebonden door anti-FLAG. An-
15 dere ligand-antiligand immobilisatie werkwijzen zijn ook geschikt (bijvoorbeeld een
immobilisatiedomein dat bestaat uit proteïne A sequenties,(Harlow en Lane, 1988, An-
tibodies A Laboratory Manual, Cold Spring Harbor Laboratory; Sigma Chemical Co.,
St. Louis, MO) kan worden gebonden door IgG; en een immobilisatiedomein dat be-
staat uit streptavidine kan worden gebonden door biotine (Harlow & Lane, hierboven;
20 Sigma Chemical Co,, St. Louis, MO). In een voorkeurs-uitvoeringsvorm is het immo-
bilisatiedomein een GST-groep zoals hierin is beschreven.
[0083] Wanneer antilichaam-bemiddelde immobilisatiewerkwijzen worden ge-
bruikt zijn glas en plastic in het bijzonder bruikbare substraten. De substraten kunnen
worden gedrukt met een hydrofobe (bijvoorbeeld Teflon) afdruk voor het vormen van
25 putjes. Vooraf gedrukte objectglaasjes met 3, 10 en 21 putjes per 14,5 cm2 van "werk-
gebied" zijn verkrijgbaar van bijvoorbeeld SPI Supplies, West Chester, PA; zie ook
Amerikaans octrooischriftnummer 4,011.350). Bij bepaalde toepassingen wordt een
groot formaat (12,4 cm x 8,3 cm) van objectglaasje gedrukt in een vorm van 96 putjes
en gebruikt; dit formaat bewerkstelligd het gebruik van geautomatiseerde inrichtingen
30 voor vloeistofbehandeling en gebruik van een plaatreaders voor een formaat van 96
putjes van verscheidene soorten (fluorescent colorimetrisch, scintillatie). Hogere
dichtheden kunnen echter worden gebruikt (bijvoorbeeld meer dan 10 of 100 Polypep-
tiden per cm2). Zie bijvoorbeeld MacBeath et al, 2000, Science 289: 1760-63.
EU 1537 415 Bl
2.MAR.2009 15:03 NED. OCTROOIBUREAU 43703527580 NO.057 P.20
ACCOUNTS
47
[0084] Kenmerkend worden antilichamen gebonden aan substraten (bijvoorbeeld
substraten van glas) door adsorptie. Geschikte omstandigheden voor adsorptie zijn in
het vakgebied goed bekend en omvatten incubatie van 0,5-50 ug/ml (bijvoorbeeld 10
ug/ml) mAb in buffer (bijvoorbeeld PBS of 50 tot 300 mM Tris, MOPS, HEPES,
5 PIPES, acetaatbuffers, pH's 6,5 tot 8, bij 4°C) tot 37°C en van 1 uur tot meer dan 24
uur.
[0085] Eiwitten kunnen op covalente wijze worden gebonden of op niet-covalente
wijze door middel van niet-specifieke binding. Indien covalente binding tussen het fu-
sie-eiwit en het oppervlak wordt gewenst zal het oppervlak gewoonlijk polyrunctioneel
10 zijn of in staat zijn polyfunctioned te worden gemaakt. Functionele groepen die aan-
wezig kunnen zijn op het oppervlak en die worden gebruikt voor het koppelen kunnen
carbonzuren, aldehyden, aminogroepen, cyaangroepen, ethyleen-groepen, hydroxyl-
groepen, mercaptogroepen en dergelijke omvatten. De wijze van het koppelen van een
brede variëteit van verbindingen aan verscheidene oppervlakken is goed bekend en is
15 ruim geïllustreerd in de literatuur.
[0086] Illustratieve testen worden hieronder verschaft.
[0087] "A Test" detectie van PDZ-ligand binding door het gebruik van
geïmmobüiseerd PL-peptide.
[0088] In één aspect verschaft de uitvinding een test waarbij gebiotinyleerde gega-
20 digde PL-peptiden worden geïmmobiliseerd op een avidine-bekleed oppervlak. De bin-
ding van PDZ-domein fusie-eiwit aan dit oppervlak wordt vervolgens gemeten. In een
voorkeursuitvoeringsvorm is het PDZ-domein fusie-eiwit een GST/PDZ fusie-eiwit en
wordt de test als volgt uitgevoerd:
25 (1) Avidine wordt gebonden aan een oppervlak, bijvoorbeeld een eiwit-bindend
oppervlak. In een uitvoeringsvorm wordt avidine gebonden aan een polystyreen
plaat met 96 putjes (bijvoorbeeld Nunc Polysorb (cat # 475094)) door toevoeging
van 100 ul per putje van 20 ug/ml avidine (Pierce) in fosfaat-gebufferde zoutop-
lossing zonder calcium en magnesium, pH 7,4 ("PBS", Gibco BRL) bij 4°C ge-
30 durende 12 uur. De plaat wordt vervolgens behandeld voor het blokkeren van
niet-specifieke interacties door toevoeging van 200 ul per putje van PBS die 2
gram per 100 ml protease-vrij runderserumalbumine bevat ("PBS/BSA") gedu-
rende 2 uur bij 4°C. De plaat wordt vervolgens 3 keer gewassen met PBS door
EU 1 537 415 Bl
2.MAR.2009 15=04 NED. OCTROOIBUREAU 43703527580 NO.057 P.21
ACCOUNTS
48
herhaaldelijk toevoegen van 200 ul per putje van PBS aan elk putje van de plaat
en vervolgens de inhoud van de plaat te verwijderen in een afval container en het
tikken van de plaat op een droog oppervlak.
(2) Gebiotinyleerde PL-peptiden (of gegadigde PL-peptiden, zie bijvoorbeeld Ta-
5 bel 3) worden geïmmobiliseerd op het oppervlak van putjes van de plaat door
toevoeging van 50 ul per putje van 0,4 uM peptide in PBS/BSA gedurende 30
minuten bij 4°C. Gewoonlijk wordt elk ander peptide toegevoegd aan tenminste
acht verschillende putjes zodat meerdere metingen (bijvoorbeeld duplo's en ook
metingen met het gebruik van verschillende (GST/PDZ-domein fusie-eiwitten en
10 een GST alleen als negatieve controle) kunnen worden gemaakt en ook aanvul-
lende putjes voor negatieve controles worden bereid waarin geen peptide wordt
geïmmobiliseerd. Volgend op immobilisatie van het PL-peptide op het oppervlak
wordt de plaat 3 keer gewassen met PBS.
(3) GST/PDZ-domein fusie-eiwit (bereid zoals hierboven is beschreven) wordt
15 mogelijk gemaakt om te reageren met het oppervlak door toevoeging van 50 ul
per putje van een oplossing die 5 ng/ml GST/PDZ-domein fusie-eiwit in
PBS/BSA bevat gedurende 2 uur bij 4°C. Als een negatieve controle wordt GST
aUeen (d.w.z. niet een fusie-eiwit) toegevoegd aan gespecificeerde putjes, in het
algemeen tenminste 2 putjes (d.w.z. metingen in duplo) voor elk geïmmobüiseerd
20 peptide. Na de reactie van 2 uur wordt de plaat 3 keer gewassen met PBS voor
het verwijderen van niet gebonden fusie-eiwit
(4) De binding van het GST/PDZ-domein fusie-eiwit aan het met avidine-gebio-
tinyleerde peptide-oppervlak kan worden gedetecteerd door het gebruik van een
verscheidenheid van werkwijzen en detectoren die in het vakgebied bekend zijn.
25 In één uitvoeringsvorm wordt 50 (il per putje van een anti-GST antilichaam in
PBS/BSA (bijvoorbeeld 2,5 ng/ml van polyklonaal anti-GST antilichaam van
geit, Pierce) toegevoegd aan de plaat en mogelijk gemaakt om te reageren gedu-
rende 20 minuten bij 4°C. De plaat wordt 3 keer gewassen met PBS en een
tweede, detecteerbaar gemerkt antilichaam wordt toegevoegd. In één uitvoerings-
30 vorm wordt 50 pl per putje van 2,5 ug/ml van mierikswortelperoxidase (HRP)-
geconjugeerd polyklonaal anti-geit immunoglobuline antilichaam van konijn toe-
gevoegd aan de plaat en mogelijk gemaakt om gedurende 20 minuten bij 4°C te
reageren. De plaat wordt 5 keer gewassen met 50 mM Tris pH 8,0 die 0,2%
EU 1537 415 Bl
2.MAR.2009 15=04 NED. OCTROOIBUREAU 43703527580 NO.057 P.22
ACCOUNTS
49
Tween 20 bevat en ontwikkeld door toevoeging van 100 ul per putje van HRP-
substraat oplossing (TMB, Dako) gedurende 20 minuten bij kamertemperatuur
(RT). De reactie van de HRP en het substraat ervan wordt beëindigd door de toe-
voeging van 100 fil per putje van 1 M zwavelzuur en de absorptie (A) van elk
5 putje van de plaat wordt afgelezen bij 450 nm.
(5) Specifieke binding van een PL-peptide en een PDZ-domein polypeptide wordt
gedetecteerd door het vergelijken van het signaal van de putje(s) waarin het PL-
peptide en PDZ-domein polypeptide zijn gecombineerd met de achtergrond sig-
nalen. Het achtergrond signaal is het signaal dat wordt gevonden bij de negatieve
10 controles. Kenmerkend zal een specifieke of selectieve reactie tenminste twee-
maal het signaal van de achtergrond zijn of meer kenmerkend meer dan 5 keer de
achtergrond en het meest kenmerkend 10 of meer keer het signaal van de achter-
grond. In aanvulling zal een statistisch significante reactie meerdere metingen
van de reactie behelzen waarbij het signaal en de achtergrond met tenminste twee
15 standaardfouten verschillen, meer kenmerkend vier standaardfouten en meest
kenmerkend zes of meer standaardfouten. Dienovereenkomstig zal een statisti-
sche test (bijvoorbeeld een T-test) die herhaalde metingen van het signaal verge-
lijkt met herhaalde metingen van de achtergrond resulteren in een p-waarde <
0,05, meer kenmerkend een p-waarde < 0,01 en meest kenmerkend een p-waarde
20 < 0,001 of lager.
[0089] Zoals is opgemerkt is in een uitvoeringsvorm van de "A" test het signaal
van binding van een GST/PDZ-domein fusie-eiwit aan een avidine-oppervlak dat niet
wordt blootgesteld aan (d.w.z. niet wordt bekleed met) het PL-peptide een geschikte
25 negatieve controle (soms naar verwezen als "B"). Het signaal van binding van GST
polypeptide alleen (d.w.z. niet een fusie-eiwit) aan een met avidine-bekleed oppervlak
dat is blootgesteld geweest aan (d.w.z. bekleed met) het PL-peptide is een tweede ge-
schikte negatieve controle (soms naar verwezen als "B2"). Omdat alle metingen in
veelvouden worden uitgevoerd (d.w.z. tenminste in duplo) wordt het rekenkundige ge-
30 middelde (of op gelijkwaardig wijze het gemiddelde) van verscheidene metingen ge-
bruikt bij het bepalen van de binding en de standaardfout van het gemiddelde wordt
gebruikt bij het bepalen van de waarschijnlijke fout bij de meting van de binding. De
standaardfout van het gemiddelde van N metingen is gelijk aan de vierkantwortel van
EU 1537 415 Bl
2.MAR.2009 15:05 NED. OCTROOIBUREAU 43703527580 NO.057 P.23
ACCOUNTS
50
het volgende: de som van het kwadraat van het verschil tussen elke meting en het ge-
middelde, gedeeld door het product van (N) en (N-l). In één uitvoeringsvorm wordt
specifieke binding van het PDZ-eiwit aan het plaat-gebonden PL-peptide aldus bepaald
door het vergelijken van het gemiddelde signaal ("gemiddelde S") en standaardfout van
het signaal ("SE") voor een specifieke PL-PDZ combinatie met de gemiddelde Bl
en/of gemiddelde B2.
"G-test" detectie van PDZ-Ligand binding door het gebruik van geïmmobiliseerd PDZ-
domein füsie-polvpeptide
10
15
[0090] In één aspect verschaft de uitvinding een test waarbij een GST/PDZ fusie-
eiwit is geïmmobiliseerd op een oppervlak ("G" test). De binding van gemerkt PL-pep-
tide (bijvoorbeeld zoals is opgesomd in Tabel 3) aan dit oppervlak wordt vervolgens
gemeten. In een uitvoeringsvorm die van voorkeur is wordt de test als volgt uitgevoerd:
(1) Een PDZ-domein polypeptide wordt gebonden aan een oppervlak, bijvoor-
beeld een eiwit-bindend oppervlak. In een voorkeursuitvoeringsvorm wordt een
GST/PDZ fusie-eiwit dat één of meer PDZ-domeinen bevat, gebonden aan een
polystyreenplaat met 96 putjes. Het GST/PDZ fusie-eiwit kan aan de plaat wor-
20 den gebonden door elk van een verscheidenheid van standaard-werkwijzen die bij
de deskundige in het vakgebied bekend zijn, alhoewel enige zorg moet worden
genomen dat het proces van binding van het fiisie-eiwit aan de plaat niet de li-
gand-bindende eigenschappen van het PDZ-domein verandert In één uitvoe-
ringsvorm wordt het GST/PDZ fusie-eiwit gebonden door middel van een anti-
25 GST antüichaam dat is bekleed op een plaat met 96 putjes, Voldoende binding
aan de plaat kan worden bereikt wanneen
a. 100 nl per putje van 5 ng/ml anti-GST polyklonaal antilichaam van geit
(Pierce) in PBS wordt toegevoegd aan een polystyreen plaat met 96 putjes
30 (bijvoorbeeld Nunc Polysorb) bij 4°C gedurende 12 uur.
b. De plaat wordt geblokkeerd door de toevoeging van 200 nl per putje van
PBS/BSA gedurende 2 uur bij 4°C.
c. De plaat wordt 3 keer gewassen met PBS.
EU 1537 415 Bl
2.MAR.2009 15:05 NED. OCTROOIBUREAU 43703527580 NO.057 P.24
ACCOUNTS
51
d. 50 ul per putje van 5 ng/ml GST/PDZ fusie-eiwit of, als een negatieve
controle, GST polypeptide alleen (dw.z. niet een fusie-eiwit) in PBS/BSA
wordt gedurende 2 uur bij 4°C aan de plaat toegevoegd,
e. De plaat wordt weer 3 keer gewassen met PBS.
5
(2) Gebiotinyleerde PL-peptiden worden toegestaan te reageren met het opper-
vlak door toevoeging van 50 nl per putje van een oplossing van 20 nM van het
gebiotinyleerde peptide in PBS/BSA gedurende 10 minuten bij 4°C gevolgd door
een incubatie gedurende een aanvullende 20 minuten bij 25°C. De plaat wordt 3
10 keer gewassen met ijskoude PBS.
(3) De binding van het gebiotinyleerde peptide aan het oppervlak met het
GST/PDZ fusie-eiwit kan worden gedetecteerd door het gebruik van een ver-
scheidenheid van werkwijzen en detectoren die bij de deskundigen in het vakge-
bied bekend zijn. In één uitvoeringsvorm wordt 100 ul per putje van 0,5 ng/ml
15 streptavidine-mierikswortelperoxidase (HRP) conjugaat opgelost in BSA-PBS
toegevoegd en toegestaan te reageren gedurende 20 minuten bij 4°C. De plaat
wordt vervolgens 5 keer gewassen met 50 mM Tris pH 8,0 die 0,2% Tween 20
bevat en ontwikkeld door toevoeging van 100 ul per putje van HRP-substraat
oplossing (TMB, Dako) gedurende 20 minuten bij kamertemperatuur (RT), De
20 reactie van het HRP en het substraat ervan wordt beëindigd door de toevoeging
van 100 ni P01 PutJe van 1 M zwavelzuur en de absorptie van elk putje van de
plaat wordt bij 450 nm afgelezen.
(4) Specifieke binding van een PL-peptide en een PDZ-domein polypeptide wordt
bepaald door het vergelijken van het signaal van de putje(s) waarin het PL-pep-
25 tide en PDZ-domein zijn gecombineerd met de signalen van de achtergrond. Het
signaal van de achtergrond is het signaal dat wordt gevonden in de negatieve
controle(s). Een specifieke of selectieve reactie zal kenmerkend tenminste twee
keer het signaal van de achtergrond zijn, meer kenmerkend meer dan 5 keer de
achtergrond en het meest kenmerkend 10 of meer keer het signaal van de achter-
30 grond. Ih aanvulling zal een statistisch significante reactie meerdere metingen
van de reactie behelzen waarbij het signaal en de achtergrond met tenminste twee
standaardfouten verschillen, meer kenmerkend met vier standaardfouten en meest
kenmerkend met zes of meer standaardfouten. Dienovereenkomstig zal een sta-
EU 1537 415 Bl
2.MAR.2009 15:05 NED. OCTROOIBUREAU 43703527580 NO.057 P.25
ACCOUNTS
52
tistische test (bijvoorbeeld een T-test) die herhaalde metingen van het signaal
vergelijkt met herhaalde metingen van de achtergrond resulteren in een p-waarde
< 0,05, meer kenmerkend een p-waarde van < 0,01 en meest kenmerkend een p-
waarde van < 0,001 of lager. Zoals is opgemerkt is in een uitvoeringsvonn van de
5 "G" test het signaal van binding van een bepaald PL-peptide aan geïmmobüiseerd
(oppervlak gebonden) GST-polypeptide alleen één geschikte negatieve controle
(waarnaar soms wordt verwezen als "Bl"). Omdat alle metingen in veelvouden
worden uitgevoerd (d.w.z. tenminste in duplo) wordt het rekenkundige gemid-
delde (of op gelijkwaardige wijze, het gemiddelde) van verscheidene metingen
10 gebruikt bij het bepalen van de binding en de standaardfout van het gemiddelde
wordt gebruikt bij het bepalen van de waarschijnlijke fout bij de meting van de
binding. De standaardfout van het gemiddelde van N metingen is geüjk aan de
vierkantwortel van het volgende: de som van het kwadraat van het verschü tussen
elke meting en het gemiddelde, gedeeld door het product van (N) en (N-l). Ih één
15 uitvoeringsvorm wordt specifieke binding van het PDZ-eiwit aan het aan de
plaat-gebonden peptide aldus bepaald door het vergelijken van het gemiddelde
signaal ("gemiddelde S") en standaardfout van het signaal ("SE") voor een speci-
fieke PI^PDZ combinatie met het gemiddelde B1.
20 "G' test" en "G" test"
[0091] Twee specifieke modificaties van de specifieke omstandigheden die hierbo-
ven zijn beschreven voor de "G test" zijn in het bijzonder bruikbaar. De gemodifi-
ceerde testen gebruiken kleinere hoeveelheden van gemerkt PL-peptide en hebben
25 enigszins andere biochemische vereisten voor detectie van PDZ-ligand binding in ver-
gelijking met de specifieke testomstandigheden die hierboven zijn beschreven.
[0092] Voor het gemak wordt naar de testomstandigheden die in dit deel zijn be-
schreven verwezen als de "G' test" en de "G" test", waarbij naar de specifieke omstan-
digheden die zijn beschreven in het voorgaande deel over G-testen wordt verwezen als
30 de "G° test". De "G' test" is identiek aan de "G° test" behalve bij stap (2) de peptide
concentratie 10 nM is in plaats van 20 nM. Dit resulteert in een enigszins lagere ge-
voeligheid voor detectie van interacties met lage affiniteit en/of hogere dissociatiesnel-
heid. Dienovereenkomstig verhoogt het lichtelijk de zekerheid dat de gedetecteerde
EU 1537 415 Bl
2.MAR.2009 15:06 NED. OCTROOIBUREAU 43703527580 NO.057 P.26
ACCOUNTS
53
interacties van voldoende affiniteit en halfwaardetijd om van biologisch belang te zijn
en om bruikbare therapeutische doelwitten te zijn.
[0093] De "G" test" is identiek aan de "G0 test" behalve dat bij stap (2) de peptide
concentratie 1 nM is in plaats van 20 nM en de incubatie wordt uitgevoerd gedurende
5 60 minuten bij 25°C (in plaats van bijvoorbeeld 10 minuten bij 4°C gevolgd door 20
minuten bij 25 °C). Dit resulteert in lagere gevoeligheid voor interacties van lage affi-
niteit, hoge dissociatiesnelheid en/of affiniteit die lager is bij 25°C dan bij 4°C. Inter-
acties zullen lagere affiniteit hebben bij 25°C dan bij 4°C indien (zoals we in het alge-
meen hebben gevonden voor PDZ-ligand binding) de entropie van de reactie negatiefis
10 (d.w.z. de entropie van de producten is lager dan de entropie van de reactanten). In te-
genstelling kan het signaal van binding van PDZ-PL geüjk zijn in de "G" test" en de
"G° test" voor interacties met een trage associatie en dissociatie-snelheid, omdat het
PDZ-PL complex zal accumuleren gedurende de langere incubatie van de "G" test".
VergeUjking van de resultaten van de "G" test" en de "G° test" kan aldus worden ge-
15 . bruikt voor het schatten van relatieve entropieèn, enthalpieën en kinetiek van verschü-
lende PDZ-PL interacties, (Entropieën en enthalpieën zijn gerelateerd aan bindingsaffi-
niteit door de vergeUjking delta G = RT In (Kd) = delta H - T delta S, waarbij delta G,
H en S respectieveUjk de vrije energie van de reactie, de enthalpie en de entropie zijn,
T de temperatuur in graden Keivin is, R de gasconstante is en Kd de evenwichtsdisso-
20 ciatieconstante is). Ih het bijzonder hebben interacties die aUeen of veel sterker worden
gedetecteerd in de "G° test" in het algemeen een hoge dissociatiesnelheid bij 25°C (tl/2
< 10 minuten) en een negatieve entropie van de reactie, terwijl interacties die als geüjke
sterk worden gedetecteerd in de "G" test" in het algemeen een tragere dissociatiesnel-
heid hebben bij 25°C (tl/2 > 10 minuten). Ruwe schatting van de thermodynamica en
25 kinetiek van PDZ-PL interacties (zoals kan worden bereikt door vergeUjking van re-
sultaten van de "G° test" versus de "G" test" zoals hierboven is uiteengezet) kan wor-
den gebruikt bij het ontwerp van efficiënte remmers van de interacties. Een remmer in
de vorm van een klein molecuul die is gebaseerd op de chemische structuur van een PL
dat traag dissocieert van een bepaald PDZ-domein (zoals wordt bewezen door overeen-
30 komstige binding in de "G" test" als in de "G° test") kan zichzelf op trage wijze disso-
ciëren en aldus van hoge affiniteit zijn.
[0094] Op deze wijze kan variatie van de temperatuur en de duur van stap (2) van
de "G test" worden gebruikt voor het verschaffen van inzicht in de kinetiek en thermc-
EU 1537 415 Bl
2.MAR.2009 15:07 NED. OCTROOIBUREAU 43703527580 NO.057 P.27
ACCOUNTS
54
dynamica van de PDZ-ügand bindingsreactie en in het ontwerp van remmers van de
reactie.
Variaties van de test
5
[0095] Zoals hierboven is beschreven zal het duideüjk zijn dat veel van de stappen
in de hierboven beschreven testen kunnen worden gevarieerd, bijvoorbeeld kunnen ver-
scheidene substraten worden gebruikt voor binding van de PL en PDZ-bevattende ei-
witten; verschillende soorten van PDZ-bevattende fusie-eiwitten kunnen worden ge-
10 bruikt; verschillende merkers voor het detecteren van PDZ/PL interacties kunnen wor-
den gebruikt; en verschülende wijzen van detectie kunnen worden gebruikt
[0096] De PDZ-PL detectietesten kunnen gebruik maken van een verscheidenheid
van oppervlakken voor het binden van de PL en/of PDZ-bevattende eiwitten. Een op-
pervlak kan bijvoorbeeld een "testplaat" zijn die is gevormd van een materiaal (bij-
15 voorbeeld polystyreen) dat hechting van ofwel het PL-eiwit of het PDZ-bevattende ei-
wit daar aan optimaüseert. In het algemeen zullen de afzonderiijke putjes van de test-
plaat een hoge verhouding van oppervlaktegebied tot volume hebben en daardoor is een
geschikte vorm een putje met een platte bodem (waarbij de eiwitten van de testen
hechten zijn). Andere oppervlakken omvatten, maar zijn niet beperkt tot, korrels van
20 polystyreen of glas, objectglaasjes van polystyreen of glas, papier, dipsticks, soorten
plastic, films en dergeüjke,
[0097] De testplaat kan bijvoorbeeld een "microtiter" plaat zijn. De term "microti-
ter" plaat verwijst wanneer het hierin wordt gebruikt naar een testplaat met meerdere
putjes, die bijvoorbeeld van tussen ongeveer 30 tot 200 afzonderiijke putjes, zoals 96
25 putjes, heeft. Als alternatief kunnen array's met hoge dichtheid worden gebruikt. De
afzonderiijke putjes van de microtiterplaat zuUen vaak een maximaal volume van on-
geveer 250 nl omvatten. Op geschikte wijze is de testplaat een polystyreen plaat met 96
putjes (zoals die welke worden verkocht door Becton Dickinsomn Labware, Lincoln
Park, N.J.) die automatisering en screening bij hoge doorvoer mogehjk maakt. Andere
30 oppervlakken omvatten polystyreen microtiter ELISA platen zoals die welke worden
verkocht door Nunc Maxisorp, Inter Med, Denemarken. Vaak zal ongeveer 50 ul tot
300 nl» met meer voorkeur 100 nl tot 200 nl van een waterig monster dat buffers omvat
die daarin zijn gesuspendeerd, aan elk putje van de testplaat worden toegevoegd.
EU 1537 415 Bl
2.MAR.2009 15:07 NED. OCTROOIBUREAU 43703527580 NO.057 P.28
ACCOUNTS
55
[0098] De detecteerbare merkers van de uitvinding kunnen elke detecteerbare
verbinding of samenstelling zijn die op directe of indirecte wijze is geconjugeerd met
een molecuul (zoals hierboven is beschreven). De merker kan zelf detecteerbaar zijn
(bijvoorbeeld radioactieve isotoop merkers of fluorescente merkers) of kan in het geval
5 van een enzymatische merker een chemische verandering van een substraat verbinding
of samenstelling katalyseren die detecteerbaar is. De merker die van voorkeur is, is een
enzymatische merker die een kleurverandering van een niet-radioactief kleurreagens
katalyseert.
[0099] Soms wordt de merker op indirecte wijze geconjugeerd met het antiü-
10 chaam. Een deskundige in het vakgebied is op de hoogte van verscheidene technieken
voor directe en indirecte conjugatie. Het antüichaam kan bijvoorbeeld worden geconju-
geerd met biotine en elk van de categorieën van merkers die hierboven zijn beschreven
kunnen worden geconjugeerd met avidine of omgekeerd (zie ook "A" en "G" test hier-
boven). Biotine bindt op selectieve wijze aan avidine en de merker kan aldus met het
15 antüichaam worden geconjugeerd op deze indirecte wijze. Zie Ausubel hierboven voor
een samenvatting van technieken die biotine-avidine conjugatie behelzen en overeen-
komstige testen. Als alternatief wordt om indirecte conjugatie van de merker met het
antüichaam te verkrijgen, het antüichaam geconjugeerd met een klein hapteen (bij-
voorbeeld digoxine) en één van de verschülende soorten van merkers die hierboven
20 zijn genoemd wordt geconjugeerd met een anti-hapteen antiUchaam (bijvoorbeeld anti-
digoxine antilichaam). Aldus kan indirecte conjugatie van de merker met het antiU-
chaam worden verkregen,
[0100] Test variaties kunnen verschillende wasstappen omvatten. Met "wassen"
wordt bedoeld het blootstellen van de vaste fase aan een waterige oplossing (gewoon-
25 hjk een buffer of celkweekmedium) op een zodanige wijze dat niet gebonden materiaal
(bijvoorbeeld niet-hechtende ceüen, niet-hechtend vangend middel, niet-gebonden li-
gand, receptor, receptorconstruct, ceüysaat of HRP antilichaam) daarvan wordt verwij-
derd. Voor het verlagen van ruis van de achtergrond is het geschikt om een detergens
op te nemen (bijvoorbeeld Triton X) in de wasoplossing. De waterige wasoplossing
30 wordt gewoonüjk afgeschonken van de putjes van de testplaat volgend op het wassen.
Op geschikte wijze kan het wassen worden bereikt door het gebruik van een geautoma-
tiseerde wasinrichting. Soms kunnen verscheidene wasstappen (bijvoorbeeld tussen
ongeveer 1 tot 10 wasstappen) nodig zijn.
EU 1 537 415 Bl
2.MAR.2009 15=08 NED. OCTROOIBUREAU 43703527580 NO.057 P.29
ACCOUNTS
56
[0101] Verscheidene buffers kunnen ook worden gebruikt in PDZ-PL detectietes-
ten. Verscheidene blokkerende buffers kunnen bijvoorbjpeld worden gebruikt voor het
verlagen van de achtergrond van de test De term "blokkerende buffer" verwijst naar
een waterige, pH-gebufferde oplossing die tenminste ééü blokkerende verbinding bevat
5 die in staat is te binden aan blootgestelde oppervlakken! van het substraat die niet zijn
bekleed met een PL of PDZ-bevattend eiwit. De blokkerende verbinding is op normale
wijze een eiwit zoals runderserumalbumine (BSA), gelatine, caseïne of melkpoeder en
vertoont geen kraisreactie met elk van de reagens in de test De blokkerende buffer
wordt in het algemeen verschaft bij een pH van tussen ongeveer 7 tot 7,5 en geschikte
10 bufferende middelen omvatten fosfaat en TRIS.
[0102] Verscheidene enzym-substraat combinaties kunnen ook worden gebruikt bij
het detecteren van PDZ-PL interacties. Voorbeelden van enzym-substraat combinaties
omvatten bijvoorbeeld:
15 (i) Mierikswortelperoxidase (HRP of HRPO) met waterstofperoxide als een sub-
i
straat, waarbij het waterstofperoxidase een voorloper van een kleurstof (bijvoor-
beeld orthofenyleendiamine [OPD] of 3,3\5,5>-tdtramethylbenzidine-hydrochlo-
ride [TMB] oxideert (zoals hierboven is beschreven).
(ü) alkaüsche fosfatase (AP) met para-Nitrofenylfosfaat als chromogeen sub-
20 straat.
(iii) Bèta-D-galactosidase (Bèta-D-Gal) met een chromogeen substraat (bijvoor-
beeld p-nitrofenyl-Bèta-D-galactosidase) of fluoroigeen substraat 4-mefhylumbel-
liferyl-beta-D-galactosidase,
25 [0103] Talrijke andere enzym-substraat combinaties zijn verkrijgbaar voor de des-
kundigen in het vakgebied. Zie voor een algemeen overzicht van deze Amerikaanse
octrooischriftnummers 4.275.149 en 4.318.980, die beïde hierin door verwijzing zijn
opgenomen.
[0104] Het zal verder duidelijk zijn dat, alhoewel Voor het gemak, de onderhavige
30 beschrijving voornameüjk verwijst naar detectie van PDZ-PL interacties, agonisten of
antagonisten van PDZ-PL interacties kunnen worden gebruikt voor het diagnosticeren
van ceUulaire abnormaüteiten.
EU 1537 415 Bl
2.MAR.2009 15:08 NED. OCTROOIBUREAU 43703527580 NO.057 P.30
ACCOUNTS
57
V, Verzameling van weefselmonsters zoals cervicale weefsels
[0105] Het diagnosticeren van de aanwezigheid: van pathogenen vereist de
j
verzameling van monsters die geschikt zijn voor het organisme. Voor detectie van on-
5 cogene HPV E6-eiwitten zou men weefsel verzamelen voor het testen van de cervix,
penis, anus of keel door het gebruik van een schraper, Wattenstafje of biopsie techniek.
Voor diagnose van bloed-afkomstige pathogenen zoals HIV zou de verzameling van
bloed door middel van standaard wijzen het meest geschikt zijn. Diagnose van schim-
mel of virale infecties die beschadigingen van de huid kunnen hebben veroorzaakt zou
10 de verzameling vereisen van een monster van het getroffen gebied.
[0106] Deze uitvinding is niet bedoeld inrichtingen voor het nemen van monsters
te omvatten. Het zou echter moeten worden opgemerkt dat omdat de uitvinding is ge-
baseerd op de detectie van PDZ of PL-eiwitten, de juiste zorg moet worden genomen
om een voldoende hoeveelheid van monster te verzamelen om eiwitten van de patho-
15 geen te detecteren en om de integriteit van eiwitten in het monster aan te houden. De
hoeveelheid monster die verzameld zou moeten wordenizou op empirische wijze moe-
ten worden bepaald voor elke diagnostische test. Factoren bij de beslissing kunnen om-
vatten, maar zijn niet beperkt tot, de fase waarop de detectie wordt gewenst, de hoe-
veelheid van pathogeen per eenheidsmonster, de hoeveelheid van diagnostisch eiwit per
20 eenheid per eenheidsmonster, beschikbaarheid van diagnostische epitopen en de stabi-
üteit van de diagnostische epitopen.
i
[0107] Illustratieve inrichtingen voor het verzamelen van cervicaal weefsel omvat-
ten, maar zijn niet beperkt tot die welke zijn beschreven iin Amerikaanse octrooischrift-
nummer 6,241.687, 6.352.513, 6.336.905, 6.115,990 en 6.346.086. Deze verzameling
25 van inrichtingen zou de verzameling van cervicaal weefsel bewerk-stelligen voor de
diagnose van infectie met oncogeen humaan papülomavirus. Deze inrichtingen zijn
voornamelijk voor verzameling van cervicale ceüen of; weefsels door afschrapen; als
alternatief zou men standaard biopsie werkwijzen kunhen gebruiken voor het verza-
melen van monsters van aUe weefsels die onderzocht diehen te worden.
30 [0108] Alhoewel de diagnostische werkwijze die is beschreven in deze aanvraag
betrekking heeft op de detectie van PL-eiwitten, hoeft de verzameling van monsters
niet beperkt te zijn tot het verzamelen van eiwitten. Men zou op alternatieve wijze
RNA van weèfselmonsters kunnen verzamelen, een in vitro translatie kit kunnen ge-
EU 1537 415 Bl
2.MAR.2009 15:13 NED. OCTROOIBUREAU 43703527580 NO.058 P.2
ACCOUNTS
58
bruiken voor het produceren van eiwit van verzamelde matrijzen en vervolgens te tes-
ten door het gebruik van werkwijzen die hierin zijn beschreven. Op een overeenkom-
stige wijze zou DNA kunnen worden verzameld van testmonsters, specifieke primers
voor oncogene E6-eiwitten zouden kunnen worden gebruikt voor ofwel het amplifice-
ren van het DNA-gehalte (door het gebruik van een DNA-polymerase) of het transcri-
beren en translateren van het monster naar eiwitten die kunnen worden getest met
werkwijzen die hierin zijn beschreven.
10
VI. Testen voor het detecteren van oncogene E6-eiwitten
[0109] Oncogene E6-eiwitten kunnen worden gedetecteerd door het vermogen er-
van om te binden aan PDZ-domeinen. Dit zou kunnen worden ontwikkeld in een bena-
deringswijze van een enkele detectiefase of met meer voorkeur als een twee-fase of
"sandwich" benaderingswijze voor verhoogde gevoeügheid en specificiteit.
15 [0110] Voor benaderingswijzen van een enkele fase kan een "gemerkte" versie van
een PDZ-domein dat op specifieke wijze oncogene E6-eiwitten herkent, zoals die
welke zijn beschreven in TabeUen 3 en 4, worden gebruikt om op directe wijze de aan-
wezigheid van oncogeen E6-eiwit in een monster te merken. Zoals hierboven is opge-
merkt zou een voorbeeld hiervan het verbinden van het testmonster aan een vaste dra-
20 ger zijn (bijvoorbeeld baarmoederhalsceüen of weefsel zouden of zou kunnen worden
bekleed op een objectglaasje en worden "gefixeerd" voor het permeabiliseren van de
celmembranen), het incuberen van het monster met een gemerkt 'TL detector" eiwit
(een PDZ-domein fusie) onder juiste omstandigheden, het wegwassen van ongebonden
PL detector en het testen op de aanwezigheid van de "merker" in het monster. In aan-
25 vulling zou men zelfs zonder merker de fysiologische eigenschappen van het PDZ-ei-
wit en het PDZ-eiwit gebonden aan een E6-eiwit kunnen meten. Technieken zoals op-
pervlakte plasmon resonantie, circulair dichroïsme en andere technieken die op directe
wijze binding bepalen, zouden kunnen worden gebruikt voor het detecteren van de
aanwezigheid van oncogene E6-eiwitten. Men zou echter moeten opmerken dat PDZ-
30 domeinen ook endogene ceUulaire eiwitten kunnen binden. Frequentie van binding
moet aldus worden vergeleken met controle cellen die niet E6 oncoproteïnen bevatten
of de "PL detector" zou zodanig moeten worden gemodificeerd dat het aanzienlijk
meer specifiek is voor de oncogene E6 eiwitten (zie deel X).
EU 1537 415 Bl
2.MAR.2009 15:13 NED. OCTROOIBUREAU 43703527580 NO.058 P.3
ACCOUNTS
59
[Olli] Voor twee-fase of sandwich benaderingswijzen is het gebruik van de PL
detector gekoppeld met een tweede werkwijze van ofwel het vangen of het detecteren
van gevangen eiwitten. De tweede werkwijze zou een antüichaam kunnen gebruiken
dat bindt aan het E6 oncoproteïne of een tweede verbinding of eiwit dat aan E6-onco-
5 proteïne kan binden op een locatie op het E6-eiwit dat de beschikbaarheid van het E6
PL niet verlaagd, Dergelijke eiwitten kunnen omvatten, maar zijn niet beperkt tot p53,
E6-AP, E6-BP of gemanipuleerde verbindingen die E6 oncoproteïnen binden. Als al-
ternatief zou men ook binding van DNA of binding van Zn2+ kunnen gebruiken om te
testen op de aanwezigheid van gevangen E6-eiwit omdat het van oncogene E6-eiwitten
10 bekend is dat ze bepaalde DNA-structuren binden door het gebruik van divalente katio-
nen, In aanvulüng zou men het PDZ-vangende E6-eiwit kunnen gebruiken in een acti-
viteitstest, omdat het van E6 bekend is dat het DNA en bepaalde eiwitten waaronder
p53 afbreekt in de aanwezigheid van een reticulocyten lysaat.
15 Antüichamen
[0112] Veel biologische testen zijn ontworpen als een "sandwich" waarbij een
antüichaam één zijde van de sandwich vormt. Deze werkwijze kan de signaal tot ruis
verhouding voor een diagnostisch middel verbeteren door het verlagen van het achter-
20 grondsignaal en het ampüficeren van juiste signalen. Antüichamen kunnen worden ge-
genereerd die op specifieke wijze het diagnostische eiwit herkennen. Omdat deze uit-
vinding de werkwijze van het gebruüc van PDZ- of PL-eiwitten voor het diagnosticeren
van infecties met pathogeen beschrijft, zouden antüichamen moeten worden gegene-
reerd die niet strijden met de PDZ:PL interactie.
25 [0113] Voor de productie van antüichamen kunnen verscheidene gastheerdieren,
waaronder maar niet beperkt tot konijnen, muizen, ratten, enzovoort, worden geïmmu-
niseerd door injectie met een peptide. Het peptide kan zijn verbonden aan een geschikte
drager zoals BSA of KLH door middel van een functionele groep van de zijketen of
linkers die zijn verbonden aan een functionele groep van een zijketen. Verscheidene
30 adjuvans kunnen worden gebruikt voor het verhogen van de immunologische respons,
afhankeUjk van de gastheersoort, waaronder maar niet beperkt tot Freund's (voUedig of
onvoüedig), minerale gels zoals aluminiumhydroxide, oppervlakte-actieve stoffen zoals
lysolecithine, pluronic polyolen, polyanionen, peptiden, oüe-emulsies, keyhole limpet
EU 1537 415 Bl
2.MAR.2009 15=14 "" NED. OCTROOIBUREAU 43703527580 NO.058 P.4
ACCOUNTS
60
hemocyanine, dinitrofenol en mogeüjke bruikbare humane adjuvans zoals BCG (bacüli
Calmette-Guerin) en Corynebacterium parvwn.
[0114] Monoklonale antilichamen tegen een peptide kunnen worden bereid door
het gebruik van elke techniek die de productie van antüichaammoleculen door continue
5 celüjnen in kweek verschaft Deze omvatten, maar zijn niet beperkt tot de hybridoma-
techniek die oorspronkelijk is beschreven door Koehler en Müstein, 1975, Nature 256:
495^497, de humane B-cel hybridoma techniek Kosbor et al, 1983, Immunology Today
4: 72; Cote et al, 1983, Proc. Natl. Acad. Sei. U.S.A. 80: 2026- 2030 en de EBV-hy-
bridoma techniek (Cole et al., 1985, Monoclonal Antibodies and Cancer Therapy, Alan
10 R. Liss, Inc., blz. 77-96 (1985)). In aanvulüng kunnen technieken die zijn ontwikkeld
voor de productie van "chimère antüichamen" (Morrison et al., 1984, Proc. Natl. Acad.
Sei. U.S.A. 81: 6851-6855; Neuberger et al., 1984, Nature 312: 604-608; Takeda et al.,
1985, Nature 314: 452-454), door het spütsen van de genen van een antüichaammole-
cuul van muis met de juiste antigeen specificiteit tezamen met genen van een humaan
15 antüichaammolecuul met gewenste biologische activiteit worden gebruikt. Als alter-
natief kunnen technieken die zijn beschreven voor de productie van antüichamen van
een enkele keten (Amerikaans octrooischriftnummer 4.946.778) worden aangepast om
peptide-specifieke antüichamen van een enkele keten te produceren.
[0115] Antüichaamfragmenten die deleties van specifieke bindingsplaatsen bevat-
20 ten kunnen worden gegenereerd door bekende technieken. DergeUjke fragmenten om-
vatten bijvoorbeeld, maar zijn niet beperkt tot F(ab')2 fragmenten die kunnen worden
geproduceerd door pepsine digestie van het antüichaammolecuul en Fab-fragmenten
die kunnen worden gegenereerd door het reduceren van de disulfidebruggen van de
F(ab')2 fragmenten. Als alternatief kunnen Fab expressiebibliotheken worden gecon-
25 strueerd (Huse et al., 1989, Science 246: 1275-1281) om sneue en eenvoudige identifi-
catie van monoklonale Fab-fragmenten met de gewenste specificiteit voor het peptide
van belang mogeüjk te maken.
[0116] Het antüichaam of antüichaamfragment dat specifiek is voor het gewenste
peptide kan bijvoorbeeld worden verbonden aan agarose en het antilichaam-agarose
30 complex wordt gebruikt bij immunochromatografie voor het zuiveren van peptiden van
de uitvinding. Zie Scopes, 1984, Protein Purification: Principles and Practice, Springer-
Verlag New York, Inc., NY, Livingstone, 1974, Methods Enzymology: frnmunoaffinity
Chromatography of Proteins 34: 723-731. AntiUchamen kunnen ook worden gekoppeld
EU 1 537 415 Bl
2.MAR.2009" 15:15 NED. OCTROOIBUREAU 43703527580 NO.058 P.5
ACCOUNTS
61
aan andere vaste dragers voor diagnostische toepassingen of als alternatief worden ge-
merkt met een middel voor detectie zoals een enzym dat een colorimetrisch substraat
kan spütsten, een fluorofoor, een magnetisch deeltje of andere meetbare samenstellin-
gen of materialen.
5 [0117] Specifieke antüichamen tegen E6-eiwitten zijn historisch moeilijk geweest
te produceren. In samenhang met de werkwijzen die hierboven zijn beschreven zou
men een aantal technieken kunnen gebruiken om de aannemelijkheid van het produce-
ren of het selecteren van antiUchamen met een hoge affiniteit kunnen verhogen. Een
voorbeeld is het bereiden van het E6 antigeen (om antüichamen ertegen op te wekken)
10 op dezelfde wijze als dat men weefsel of celmonsters zou bereiden voor het testen. Als
alternatief zou men kunnen immuniseren met E6-fusie-eiwit dat op één wijze is bereid
en het screenen op specifieke E6 antüichamen door het gebruik van een tweede E6 ei-
wit dat op een andere wijze is bereid. Dit zou selecteren op antilichamen die E6 epi-
topen herkennen die zijn geconserveerd onder verschülende procedures van verzame-
15 ling en bereiding van monsters. In een ander voorbeeld zou men dieren kunnen immu-
niseren met E6 antigeen dat snel is gedenatureerd en gerenatureerd, zodanig dat wordt
geselecteerd op epitopen die ongevoeüg zijn voor de omstandigheden van bereiding.
Een andere werkwijze die zou kunnen worden gebruikt is het gebruik van peptiden die
overeenkomen met antigene gebieden van de E6 eiwitten zoals wordt voorspeld door
20 consensus binding van het voornaamste histocompatibiüteitscomplex ("Major Histo-
compatibiüty Complex"; MHC) en T Cel Receptor (TCR). Nog een andere werkwijze
zou zijn het gebruik maken van een E6 variant die eenvoudig wordt geproduceerd (bij-
voorbeeld GST- of MBP-HPV18, hierboven beschreven) en waarvoor gebieden van
binding van antüichamen zijn bepaald. Deze "antigene" gebieden zouden kunnen wor-
25 den uitgewisseld met homologe stukken van E6 peptide van een ander soort (bijvoor-
beeld een ander epitoop voor immunisering). Het epitoop zou aldus een hogere leans
moeten hebben om op de juiste wijze te worden gepresenteerd voor antüichaam pro-
ductie.
[0118] In het algemeen kunnen geschikte anti-E6 antüichamen worden bereid door
30 het immuniseren van geschikte zoogdieren met bijvoorbeeld E6 eiwit dat is geprodu-
ceerd in zoogdierüjke ceUen (en aldus de juiste vouwing, disulfidebindingen en andere
eiwitmodificaties heeft) of E6 eiwit dat is gemodificeerd om bijvoorbeeld cysteïne-re-
siduen te vervangen met andere aminozuren, zoals in het vakgebied bekend is en in
EU 1537 415 Bl
2.MAR.2009 15:15 NED. OCTROOIBUREAU 43703527580 NO.058 P.6
ACCOUNTS
62
bacteriën wordt geproduceerd. In het algemeen kunnen bij de onderhavige werkwijzen
een mengsel van antüichamen, elk kruisreagerend met verschülende subsets van E6
eiwit, worden gebruikt Bij bepaalde uitvoeringsvormen kan een antüichaam dat kruis-
reageert met veel of aUe E6 eiwitten worden gebruikt Kenmerkende antiUchamen die
5 bruikbaar zijn in de onderhavige werkwijzen binden aan E6 eiwitten ongeacht of de E6
eiwitten oncogeen zijn.
2. Alternatieve detectiewerkwiizen voor gevangen E6-eiwit
10 [0119] E6-eiwitten die zijn gevangen door PDZ-domeinen zouden kunnen worden
getest door verscheidene alternatieve werkwijzen. Van verscheidene eiwitten is het be-
kend dat ze associëren met E6-eiwitten. Elk ervan dat een redelijke affiniteit heeft voor
E6 zou door een deskundige in het vakgebied kunnen worden gebruikt voor het detecte-
ren van de aanwezigheid van gevangen en geconcentreerd E6-eiwit in een monster. In
15 aanvulling zouden nieuwe bindende eiwitten of aptameren kunnen worden geïdentifi-
ceerd die aan E6-eiwitten binden. Als derde zouden activiteitstesten die specifiek zijn
voor E6 kunnen worden gebruikt.
[0120] De detectietest zelf zou ook kunnen worden uitgevoerd door het gebruik
van een verscheidenheid van werkwijzen. Een standaard ELISA met het gebruik van
20 een PDZ voor het vangen zou kunnen worden opgezet als een competitie waarbij bet
PDZ-domein vooraf is geladen met een gemerkte PL die een lagere affiniteit heeft dan
de E6-eiwitten. In de aanwezigheid van E6 wordt aldus de merker verdrongen en ziet
men een verlaging van signaal dat overeenkomt met de aanwezigheid van E6, Andere
varianten die gebruik maken van aspecten van competitie en remming van binding zijn
25 ook bedoeld te zijn opgenomen. Eén variant zou zelfs het PL op covalente wijze ver-
bonden kunnen hebben aan het PDZ-domein door middel van een linker zodanig dat de
PL het eigen PDZ-domein ervan zou kunnen binden. Door het gebruik van donor uit-
dovende kleurstoffen zou men aUeen een toename van signaal zien wanneer het PL van
een oncogeen E6-eiwit in staat is het gemerkte PL te verdringen. Al dergeUjke compe-
30 titiewerkwijzen moeten worden gemeten tegen controles die de hoeveelheid bepalen
van endogene PL-eiwitten die het PDZ-domein kunnen binden dat wordt gebruikt voor
het bepalen van de aanwezigheid van oncogene E6-eiwitten.
EU 1537 415 Bl
2.MAR.2009 15:16 NED. OCTROOIBUREAU 43703527580 NO.058 P.7
ACCOUNTS
63
VUL Metingen van de gevoeügheid van de test
[0121] De "A" en "G" testen van de uitvinding kunnen worden gebruikt voor het
bepalen van de "ogenschijnüjke affiniteit" van binding van een PDZ-Ugand peptide aan
5 een PDZ-domein polypeptide. Ogenschijnüjke affiniteit wordt bepaald op basis van de
concentratie van één molecuul die nodig is voor het verzadigen van de binding van een
tweede molecuul (bijvoorbeeld de binding van een Ugand aan een receptor), Twee in
het bijzonder bruikbare benaderingswijzen voor kwantificering van ogenschijnlijke
affiniteit van PDZ-Ugand binding worden hieronder verschaft. Deze werkwijzen kun-
10 nen worden gebruikt voor het vergeUjken van de gevoeUgheid en affiniteit van PL de-
tector constructen die verschülen. DuideUjkheid van de gevoeUgheid van het PDZ voor
PL's van pathogenen is essentieel omdat het helpt voor het bepalen van de hoeveelheid
weefsel of celmonster die moet worden getest om een gerechtvaardigd resultaat te ver-
krijgen.
15
(1) Een GST/PDZ fusie-eiwit alsook GST aüeen als een negatieve controle wor-
den gebonden aan een oppervlak (bijvoorbeeld een plaat met 96 putjes) en het
oppervlak wordt geblokkeerd en gewassen zoals hierboven is beschreven voor de
"G" test
20 (2) 50 nl per putje van een oplossing van gebiotinyleerd PL-peptide (bijvoorbeeld
zoals is getoond in Tabel 3) wordt toegevoegd aan het oppervlak bij toenemende
concentraties in PBS/BSA (bijvoorbeeld bij 0,1 nM, 0,33 nM, 1 nM, 3,3 nM, 10
uM, 33 nM en 100 nM). In één uitvoeringsvorm wordt het PL-peptide toegestaan
te reageren met het gebonden GST/PDZ fusie-eiwit (alsook het GST aüeen als
25 negatieve controle) gedurende 10 minuten bij 4°C gevolgd door 20 minuten bij
25°C. De plaat wordt 3 keer gewassen met ijskoude PBS voor het verwijderen
van niet gebonden gemerkt peptide.
(3) De binding van het PL-peptide aan het geïmmobiliseerde PDZ-domein poly-
peptide wordt gedetecteerd zoals hierboven is beschreven voor de "G" test.
30 (4) Voor elke concentratie van peptide wordt het netto bindende signaal bepaald
door het aftrekken van de binding van het peptide aan GST aüeen van de binding
van het peptide aan het GST/PDZ fusie-eiwit. Het netto bindende signaal wordt
vervolgens in grafiek uitgezet als een functie van Ugand concentratie en de gra-
EU 1537 415 Bl
2.MAR.2009 15:16 NED. OCTROOIBUREAU 43703527580 NO.058 P.8
ACCOUNTS
64
fiek wordt aangepast (bijvoorbeeld door het gebruik van het Kaleidagraph soft-
ware package curve fitting algorithme; Synergy Software) aan de volgende ver-
geUjking waarbij "Signaalriigancrj" het netto bindende signaal is bij PL-peptide con-
centratie "[ligand]", "Kd" de ogenschijnüjke affiniteit van de bindingsgebeurtenis
is en "Verzadigde binding" een constante is die wordt bepaald door het curve fit-
ting algoritme voor het optimaliseren van de aanpassing aan de experimentele
gegevens:
10
20
Signaalpigand] = Verzadigde binding x ([ügand]/([Ügand] + Kd))
[0122] Voor betrouwbare toepassing van de vergeUjking van hierboven is het
noodzakeUjk dat de hoogste peptide Ugand concentratie die op succesvoUe wijze expe-
rimenteel wordt getest hoger is dan, of tenminste geüjk is aan, de berekende Kd (op
geüjkwaardige wijze zou de maximale waargenomen binding gelijk moeten zijn aan de
15 berekende verzadigende binding), In gevaUen waarbij het bUjkt dat het moeiüjk is om
aan de criteria van hierboven te voldoen kan een alternatieve benaderingswijze (hieron-
der) worden gebruikt.
Benaderingswijze 2:
[0123]
(1) Een vastgestelde concentratie van een PDZ-domein polypeptide en toene-
mende concentraties van een gemerkt PL-peptide (gemerkt met bijvoorbeeld bio-
tine of fluoresceïne, zie Tabel 3 voor representatieve peptide aminozuur-sequen-
25 ties) worden tezamen gemengd in oplossing en toegestaan te reageren. In één uit-
voeringsvorm zijn peptideconcentraties die van voorkeur zijn 0,1 nM, 1 nM, 10
nM, 100 nM, 1 mM. In verscheidene uitvoeringsvormen kunnen geschikte reac-
tietijden variëren van 10 minuten tot 2 dagen bij temperaturen die variëren van
4°C tot 37°C. In sommige uitvoeringsvormen kan de identieke reactie ook wor-
30 den uitgevoerd door het gebruik van een niet-PDZ-domein-bevattend eiwit als
controle (bijvoorbeeld indien het PDZ-domein polypeptide een fusie-eiwit is kan
de fusiepartner worden gebruikt).
EU 1 537 415 Bl
2.MAR.2009 15:17 NED. OCTROOIBUREAU 43703527580 NO.058 P.9
ACCOUNTS
65
(2) PDZ-Ugand complexen kunnen van niet gebonden gemerkt peptide worden
gescheiden door het gebruik van een verscheidenheid van werkwijzen die in het
vakgebied bekend zijn, De complexen kunnen bijvoorbeeld worden gescheiden
door het gebruik van een chromatografie met scheiding op grootte met hoog
5 scheiden vermogen (HPSEC, gelfiltratie) (Rabinowitz et al? 1998, Immunity 9:
699), affiniteitschromatografie (bijvoorbeeld door het gebruik van glutathion
Sépharose korrels) en affiniteitsabsorptie (bijvoorbeeld door binding aan een anti-
GST-beklede plaat zoals hierboven is beschreven).
(3) Het PDZ-Ugand complex wordt gedetecteerd op basis van de aanwezigheid
10 van de merker op het peptideUgand door het gebruik van een verscheidenheid van
werkwijzen en detectoren die bij de deskundige in het vakgebied bekend zijn. In-
dien de merker bijvoorbeeld fluoresceïne is en de scheiding wordt verkregen door
HPSEC kan een inUne fluorescentie detector worden gebruikt. De binding kan
ook worden gedetecteerd zoals hierboven is beschreven voor de G-test
15 (4) Het PDZ-Ugand bindende signaal wordt in grafiek uitgezet als een functie van
concentratie van Ugand en de grafiek wordt aangepast (bijvoorbeeld door het ge-
bruik van het Kaleidagraph software package curve fitting algorithm) aan de vol-
gende vergeUjking waarbij "Signaalpigandj" het bindende signaal is bij PL-peptide
concentratie "[Ugand]", "Kd" de ogenschijnüjke affiniteit van de bindingsge-
20 beurtenis is en "Verzadigde binding" een constante is die wordt bepaald door het
curve fitting algoritme voor het optimaüseren van de aanpassing aan de experi-
mentele gegevens:
25
Signaalpigand] = Verzadigde binding x ([ügand]/([ügand] + Kd))
[0124] Meting van de affiniteit van binding van een een gemerkt peptide Ugand
aan een PDZ-domein polypeptide is bruikbaar omdat kennis van de affiniteit (of ogen-
schijnüjke affiniteit) van deze interactie rationeel ontwerp van remmers van de interac-
tie met bekende sterkte mogeUjk maakt. De sterkte van de remmers bij het remmen zou
30 geUjk moeten zijn aan (d.w.z. met één orde van grootte van) de ogenschijnüjke affini-
teit van binding van het gemerkte peptide Ugand aan het PDZ-domein.
[0125] In één aspect verschaft de uitvinding aldus een werkwijze voor het bepalen
van de ogenschijnüjke affiniteit van binding tussen een PDZ-domein en een Ugand
EU 1537 415 Bl
2.MAR.2009 15=17 NED. OCTROOIBUREAU 43703527580 NO.058 P.10
ACCOUNTS
66
door het immobiUseren van een polypeptide dat het PDZ-domein omvat en een niet-
PDZ-domein omvat op een oppervlak, het in contact brengen van het geïmmobüiseerde
polypeptide met een verscheidenheid van verschülende concentraties van het Ugand,
het bepalen van de hoeveelheid van binding van het Ugand aan het geïmmobüiseerde
5 polypeptide bij elk van de concentraties van het Ugand en het berekenen van de ogen-
schijnüjke affiniteit van de binding op basis van die gegevens. Kenmerkend is het po-
lypeptide dat het PDZ-domein en een niet-PDZ-domein omvat een fusie-eiwit. In één
uitvoeringsvorm is het fusie-eiwit bijvoorbeeld GST-PDZ fusie-eiwit maar andere Po-
lypeptiden kunnen ook worden gebruikt (bijvoorbeeld een fusie-eiwit dat een PDZ-do-
10 mein en elk van een verscheidenheid van epitoopmerkers, biotinylatiesignalen en der-
gelijke omvat) zolang het polypeptide kan worden geïmmobiüseerd in een oriëntatie
die niet de Ugand-bindende eigenschappen van het PDZ-domein teniet doet, bijvoor-
beeld door het verbinden van het polypeptide aan het oppervlak door middel van het
niet-PDZ-domein door middel van een anti-domein antüichaam en dat het PDZ-domein
15 als het vrije uiteinde laat Het werd bijvoorbeeld ontdekt dat het in reactie brengen van
een PDZ-GST fusiepolypeptide op directe wijze aan een plastic plaat suboptimale re-
sultaten verschafte. De berekening van bindingsaffiniteit zelf kan worden bepaald door
het gebruik van elke geschürte vergeUjking (bijvoorbeeld zoals hierboven is getoond;
zie ook Cantor en Schimmel (1980) BIOPHYSICAL CHEMISTRY WH Freeman &.
20 Co., San Francisco) of software.
[0126] In een voorkeursuitvoeringsvorm wordt het polypeptide aldus geïmmobili-
seerd door binding van het polypeptide aan een geïmmobüiseerde immunoglobuline dat
het niet-PDZ-domein bindt (bijvoorbeeld een anti-GST antilichaam wanneer een GST-
PDZ fusiepolypeptide wordt gebruikt). In een voorkeursuitvoeringsvorm wordt de stap
25 van het in contact brengen van het ligand en PDZ-domein polypeptide uitgevoerd onder
de omstandigheden die hierboven zijn verschaft bij de beschrijving van de "G" test. Het
zal duideUjk zijn dat bindingstesten op geschikte wijze worden uitgevoerd in platen met
meerdere putjes (bijvoorbeeld platen met 24 putjes, 96 putjes of platen met 384 putjes).
[0127] De onderhavige werkwijze heeft aanzienUjke voordelen boven andere
30 werkwijzen voor het meten van bmdingsaffiniteiten van affiniteiten van PDZ-PL die
kenmerkend het in contact brengen van verscheidene concentraties van een GST-PDZ
fusie-eiwit met een Ugand-bekleed oppervlak behelzen. Sommige hiervoor beschreven
werkwijzen voor het bepalen van affiniteit (bijvoorbeeld door het gebruik van geünmo-
EU 1537 415 Bl
2.MAR.2009 15=18 NED. OCTROOIBUREAU 43703527580 NO.058 P.11
ACCOUNTS
67
biliseerd Ugand en GST-PDZ eiwit in oplossing) hielden bijvoorbeeld geen rekening
met de oügomerisatie toestand van de fusie-eiwitten die werden gebruikt dat in moge-
Ujke fouten van meer dan één orde van grootte resulteert.
[0128] Alhoewel het niet voldoende is voor kwantitatieve meting van bindings-
5 affiniteit van PDZ-PL kan een schatting van de relatieve sterkte van binding van ver-
schülende PDZ-PL paren worden uitgevoerd op basis van de absolute omvang van de
signalen die werden waargenomen in de "G test". Deze schatting zal verscheidene fac-
toren weerspiegelen, waaronder biologische relevante aspecten van de interactie, waar-
onder de affiniteit- en de dissociatiesnelheid. Voor vergeüjkingen van verschülende
10 Uganden die binden aan een bepaald PDZ-domein-bevattend eiwit, hebben verschülen
in absoluut bindingssignaal aannemeUjk voornameüjk betrekking op de affiniteit- en/of
dissociatiesnelheid van de interacties van belang.
15
IX. Meting van de specificiteit van de test
[0129] Zoals hierboven is beschreven verschaft de onderhavige uitvinding krach-
tige werkwijzen voor analyse van PDZ-Ugand interacties, waaronder werkwijzen met
hoge doorvoer zoals de "G" test en affiniteitstest die hierboven is beschreven. In één
uitvoeringsvorm van de uitvinding wordt de affiniteit voor een specifiek Ugand en een
20 verscheidenheid van PDZ-eiwitten bepaald. Kenmerkend is de verscheidenheid tenmin-
ste 5 en vaak tenminste 25 of tenminste 40 verschülende PDZ-eiwitten. In een voor-
keursuitvoeringsvorm is de verscheidenheid van verschillende PDZ-eiwitten van een
specifiek weefsel (bijvoorbeeld centraal zenuwstelsel, müt, hartspier, nier) of een speci-
fieke klasse of soort van cel (bijvoorbeeld een hematopoëtische cel, een lymfocyt, een
25 neuron) en dergeUjke. In een uitvoeringsvorm die het meeste van voorkeur is verte-
genwoordigt de verscheidenheid van verschülende PDZ-eiwitten een aanzienüjke frac-
tie (bijvoorbeeld een groot deel, veel vaker tenminste 80%) van aUe van de PDZ-do-
meinen waarvan bekend is of waarvan wordt vermoed dat ze tot expressie worden ge-
bracht in het weefsel of cel(len), bijvoorbeeld aUe van de PDZ-eiwitten waarvan be-
30 kend is dat ze aanwezig zijn in lymfocyten. In een uitvoeringsvorm is de verscheiden-
heid tenminste 50%, gewoonUjk tenminste 80%, tenminste 90% of aUe van de PDZ-
eiwitten die hierin zijn beschreven als tot expressie te worden gebracht in hematopoëti-
sche ceüen.
EU 1537 415 Bl
2.MAR.2009 15=18 NED. OCTROOIBUREAU 43703527580 NO.058 P.12
ACCOUNTS
68
[0130] In één uitvoeringsvorm van de uitvinding wordt de binding van een Ugand
aan de verscheidenheid van PDZ-eiwitten bepaald. Door het gebruik van deze werk-
wijze is het mogeUjk om een specifiek PDZ-domein dat met een specifieke specificiteit
wordt gebonden door het Ugand te identificeren. De binding kan worden aangeduid als
5 "specifiek" indien de affiniteit van het Ugand voor het specifieke PDZ-domein tenmin-
ste 2-voudig is van die van binding aan andere PDZ-domeinen in de verscheidenheid
(bijvoorbeeld aanwezig in die celsoort), De binding wordt beoordeelt als "zeer speci-
fiek" indien de affiniteit tenminste 10-voudig hoger is dan voor elke andere PDZ in de
verscheidenheid van, of als alternatief tenminste 10-voudig hoger dan voor tenminste
10 90%, meer vaak 95% van de andere PDZ's in een gedefinieerde verscheidenheid. Op
overeenkomstige wijze wordt de binding beoordeelt als "uiterst specifiek" indien het
tenminste 100-voudig hoger is. Een Ugand zou bijvoorbeeld aan 2 verschülende PDZ's
kunnen binden met een affiniteit van 1 nM en aan geen andere PDZ's van een set van
40 met een affiniteit van lager dan 100 [iM. Dit zou specifieke binding aan die 2 PDZ's
15 vormen. Overeenkomstige maatstavenetingen van specificiteit worden gebruüct voor
het beschrijven van binding van een PDZ aan een verscheidenheid van PL's.
[0131] Het zal duideUjk zijn dat PDZ-PL interacties met hoge specificiteit moge-
Ujk meer waardevoUe doelwitten vertegenwoordigen voor het verkrijgen van een ge-
wenst biologisch effect. Het vermogen van een remmer of een versterker om met hoge
20 specificiteit te werken wordt vaak gewenst. In het bijvonder zijn de meest specifieke
PDZ-Ugand interacties ook de diagnostische doelwitten die specifieke detectie van de
interactie of ontwrichting van een interactie mogelijk maken.
[0132] In één uitvoeringsvorm verschaft de uitvinding aldus een werkwijze voor
het identificeren van een interactie met hoge specificiteit tussen een specifiek PDZ-do-
25 mein en een Ugand waarvan bekend is of waarvan wordt vermoed dat het tenminste één
PDZ-domein bindt, door het verschaffen van een verscheidenheid van verschülende
geïmmobiliseerde Polypeptiden, waarbij elk van de Polypeptiden een PDZ-domein en
een niet-PDZ-domein omvat; het bepalen van de affiniteit van het Ugand voor elk van
de Polypeptiden en het vergeUjken van de affiniteit van binding van het Ugand aan elk
30 van de Polypeptiden, waarbij een interactie tussen het Ugand en een specifiek PDZ-do-
mein wordt beoordeeld een hoge specificiteit te hebben wanneer het Ugand een geïm-
mobiüseerd polypeptide dat het specifieke PDZ-domein omvat bindt met tenminste 2-
EU 1537 415 Bl
2.MAR.2009 15=19 NED. OCTROOIBUREAU 43703527580 NO.058 P.13
ACCOUNTS
69
voudig hogere affiniteit dan aan geïmmobüiseerde Polypeptiden die niet het specifieke
PDZ-domein omvatten.
[0133] In een verwant aspect wordt de affiniteit van binding van een specifiek
PDZ-domein aan een verscheidenheid van Uganden (of vermoede Uganden) bepaald. In
5 één uitvoeringsvorm verschaft de uitvinding bijvoorbeeld een werkwijze voor het iden-
tificeren van een interactie met hoge specificiteit tussen een PDZ-domein en een speci-
fiek Ugand waarvan bekend is of wordt vermoed dat het tenminste één PDZ-domein
bindt, door het verschaffen van een geïmmobüiseerd polypeptide dat het PDZ-domein
en een niet-PDZ-domein omvat; het bepalen van de affiniteit van elk van een verschei-
10 denheid van liganden voor het polypeptide en het vergeüjken van de affiniteit van bin-
ding van elk van de Uganden aan het polypeptide, waarbij een interactie tussen een spe-
cifiek Ugand en het PDZ-domein wordt beoordeeld hoge specificiteit te hebben wan-
neer het Ugand een geïmmobiliseerd polypeptide dat het PDZ-domein omvat bindt met
tenminste 2-voudig hogere affiniteit dan andere liganden die zijn getest De binding kan
15 aldus worden aangeduid als "specifiek" indien de affiniteit van het PDZ voor de speci-
fieke PL tenminste 2-voudig is van die van de binding aan andere PL's in de verschei-
denheid (bijvoorbeeld aanwezig in dat celsoort). De binding wordt beoordeelt "zeer
specifiek" te zijn indien de affiniteit tenminste 10-voudig hoger is dan voor elke andere
PL in de verscheidenheid of als alternatief tenminste 10-voudig hoger dan voor tenmin-
20 ste 90%, meer vaak 95% van de andere PL's in een gedefinieerde verscheidenheid. Op
overeenkomstige wijze wordt de binding als "uiterst specifiek" beoordeelt indien het
tenminste 100-voudig hoger is. De verscheidenheid is kenmerkend tenminste 5 ver-
schülende Uganden, meer vaker tenminste 10.
25 A. Gebruik van array voor globale voorspellingen
[0134] Eén ontdekking van de onderhavige uitvinders heeft betrekking op de
belangrijke en uitgebreide roUen die worden gespeeld door interacties tussen PDZ-ei-
witten en PL-eiwitten, in het bijzonder bij de biologische functie van hematopoëtische
30 ceUen en andere ceUen die zijn betrokken bij de immuunrespons. Het is verder ontdekt
dat waardevoüe informatie kan worden vastgesteld door analyse (bijvoorbeeld geüjk-
tijdige analyse) van een groot aantal van PDZ-PL interacties. In een voorkeursuitvoe-
ringsvorm omvat de analyse aUe van de PDZ-eiwitten die tot expressie worden ge-
EU 1537 415 Bl
2.MAR.2009 15=19 NED. OCTROOIBUREAU 43703527580 NO.058 P.14
ACCOUNTS
70
bracht in een specifiek weefsel (bijvoorbeeld mUt) of soort of klasse van cel (bijvoor-
beeld hematopoëtische cel, neuron, lymfocyt B-cel, T-cel en dergeUjke). Als alternatief
omvat de analyse tenminste ongeveer 5, of tenminste ongeveer 10, of tenminste onge-
veer 12, of tenminste ongeveer 15 en vaak tenminste 50 verschülende Polypeptiden tot
5 ongeveer 60, ongeveer 80, ongeveer 100, ongeveer 150, ongeveer 200, of zelfs meer
verschülende Polypeptiden; of een aanzienüjke fractie (bijvoorbeeld kenmerkend een
overgroot deel, meer vaak tenminste 80%) van aüe van de PDZ-eiwitten waarvan be-
kend is of waarvan wordt vermoed dat ze tot expressie worden gebracht in het weefsel
of de cel(len), bijvoorbeeld aUe van de PDZ-eiwitten waarvan bekend is dat ze aanwe-
10 zig zijn in lymfocyten.
[0135] Het zal duideUjk zijn dat de arrays en werkwijzen van de uitvinding betrek-
king hebben op de analyse van PDZ en PL interacties en selectie van dergeUjke eiwit-
ten behelzen voor analyse. Terwijl de inrichtingen en werkwijzen van de uitvinding een
klein aantal van controle Polypeptiden kunnen omvatten of behelzen, omvatten ze
15 kenmerkend niet aanzienüjke aantaüen van eiwitten of fusie-eiwitten die niet ofwel
PDZ of PL-domeinen omvatten (bijvoorbeeld kenmerkend tenminste ongeveer 90%
van de gerangschikte of geïmmobüiseerde Polypeptiden in een werkwijze of inrichting
van de uitvinding is een PDZ- of Pl^sequentie eiwit meer vaak temninste ongeveer
95%, of tenminste ongeveer 99%).
20 [0136] Het zal uit deze beschrijving duideUjk zijn dat analyse van het relatieve
grote aantal van verschülende interacties bij voorkeur geüjktijdig plaatsvindt. In deze
samenhang betekent "geUjktijdig" dat de analyse van verscheidene verschülende PDZ
PL interacties (of het effect van een testmiddel op dergeUjke interacties) op hetzelfde
moment wordt bepaald. De analyse wordt kenmerkend uitgevoerd op een wijze van
25 hoge doorvoer (bijvoorbeeld door een robot). Eén voordeel van deze werkwijze van
geüjktijdige analyse is dat het zorgvuldige vergeUjking van meerdere verschülende
PDZ-PL interacties mogeUjk maakt. Zoals in detaü elders hierin is uitgelegd bewerk-
stelügd geüjktijdige analyse (en het gebruik van de arrays die hierboven zijn beschre-
ven) bijvoorbeeld de directe vergeUjking van het effect van een middel (bijvoorbeeld
30 een mogeUjke remmer van de interactie) op de interacties tussen een aanzienüjk deel
van PDZ' s en/of PL' s in een weefsel of cel.
[0137] Dienovereenkomstig verschaft de uitvinding in één aspect een array van
geïmmobüiseerd polypeptide dat het PDZ-domein en een niet-PDZ-domein op een op-
EU 1537 415 Bl
2.MAR.2009 15=20 NED. OCTROOIBUREAU 43703527580 NO.058 P.15
ACCOUNTS
71
pervlak omvat De array omvat kenmerkend tenminste ongeveer 5, of tenminste onge-
veer 10, of tenminste ongeveer 12, of tenminste ongeveer 15 en vaak tenminste 50 ver-
schülende Polypeptiden. In één voorkeursuitvoeringsvorm zijn de verschülende PDZ-
eiwitten van een specifiek weefsel (bijvoorbeeld centraal zenuwstelsel, müt, hartspier,
5 nier) of een specifieke klasse of soort van cel (bijvoorbeeld hematopoëtische cel, een
lymfocyt, een neuron) en dergeUjke. In een uitvoeringsvorm die het meeste van voor-
keur is vertegenwoordigd de verscheidenheid van verschülende PDZ-eiwitten een aan-
zienüjke fractie (bijvoorbeeld kenmerkend een overgroot deel, meer vaak tenminste
60%, 70% of 80%) van aüe van de PDZ-eiwitten waarvan bekend is of waarvan wordt
10 vermoed dat ze tot expressie worden gebracht in weefsel of cel(len), bijvoorbeeld aüe
van de PDZ-eiwitten waarvan bekend is dat ze aanwezig zijn in lymfocyten.
[0138] Bepaalde uitvoeringsvormen zijn arrays die een verscheidenheid, gewoon-
Ujk tenminste 5, 10, 25, 50 PDZ-eiwitten omvatten die aanwezig zijn in een specifieke
cel van belang. In deze samenhang verwijst "array" naar een geordende serie van ge-
15 immobiliseerde Polypeptiden waarbij de identiteit van elk polypeptide is geassocieerd
met de locatie ervan. Bij sommige uitvoeringsvormen is de verscheidenheid van Poly-
peptiden gerangschikt in een "algemeen" gebied zodanig dat ze geUjktijdig kunnen
worden blootgesteld aan een oplossing (bijvoorbeeld die een ügand of testrniddel be-
vat). De verscheidenheid van Polypeptiden kan bijvoorbeeld op een objectglaasje, plaat
20 of overeenkomstig oppervlak zijn dat plastic, glas, metaal, siücium, korrels of ander
oppervlak kan zijn waar aan eiwitten kunnen worden geïmmobüiseerd. In een andere
uitvoeringsvorm zijn de verschülende geïmmobüiseerde Polypeptiden gesitueerd in
afzonderiijke gebieden zoals verschülende putjes van een plaat met meerdere putjes
(bijvoorbeeld een plaat met 24 putjes, een plaat met 96 putjes, een plaat met 384 putjes
25 en dergelijke). Het zal duideUjk zijn dat een overeenkomstig voordeel kan worden ver-
kregen door het gebruik van meerdere arrays achter elkaar.
B. Analyse van het profiel van remming van PDZ-PL
30 [0139] In één aspect verschaft de uitvinding een werkwijze voor het bepalen of een
testverbinding een PDZ-Ugand interactie in een grote set van PDZ-Ugand interacties
(bijvoorbeeld een verscheidenheid van de PDZ-ügand interacties die zijn beschreven in
Amerikaanse octrooi-aanvraag 09/724553; een groot deel van de PDZ-Uganden die zijn
EUl 537415 Bl
2.MAR.2009 15=20 NED. OCTROOIBUREAU 43703527580 NO.058 P.16
ACCOUNTS
72
geïdentificeerd in een specifieke cel of weefsel zoals hierboven is beschreven (bijvoor-
beeld cervicaal weefsel) en dergeUjke) remt. In één uitvoeringsvorm worden de PDZ-
domeinen van belang tot expressie gebracht als GST-PDZ fusie-eiwitten en geïmmobi-
üseerd zoals hierin is beschreven. Voor elk PDZ-domein wordt een gemerkt Ugand dat
5 aan het domein bindt met een bekende affiniteit geïdentificeerd zoals hierin is beschre-
ven.
[0140] Voor elke bekende of vermoede modulator (bijvoorbeeld remmer) van
(een) PDZ-PL interactie(s) is het bruikbaar om te weten welke interacties worden ge-
remd (of versterkt). Deze informatie zou kunnen worden gebruikt als een diagnostische
10 merkers voor de aanwezigheid van een pathogeen (bijvoorbeeld oncogene HPV-stam-
men). Naar het profiel van PDZ interacties die worden geremd door een specifiek mid-
del wordt verwezen als het "rernmingsprofiel" voor het middel en is in detaü hieronder
beschreven. Naar het profiel van PDZ interacties die worden versterkt door een speci-
fiek middel wordt verwezen als het "versterkingsprofiel" voor het middel. Het zal een-
15 voudig duideUjk zijn voor de deskundige in het vakgebied die de beschrijving van het
remmingsprofiel als richtüjn heeft hoe het versterkingsprofiel moet worden bepaald
voor een middel. De onderhavige uitvinding verschaft werkwijzen voor het bepalen van
het (remming/versterking) profiel van de PDZ interactie van een middel in een enkele
test
20 [0141] In één aspect verschaft de uitvinding een werkwijze voor het bepalen van
het rernmingsprofiel van PDZ-PL van een verbinding door het verschaffen van (i) een
verscheidenheid van verschülende geïmmobiliseerde Polypeptiden waarbij elk van de
Polypeptiden een PDZ-domein en een niet-PDZ-domein omvatten en (ii) een verschei-
denheid van overeenkomstige Uganden, waarbij elke ligand tenminste één PDZ-domein
25 in (i) bindt, vervolgens het in contact brengen van elk van de geïmmobüiseerde Poly-
peptiden in (i) met een overeenkomstig Ugand in (ü) in de aanwezigheid en afwezig-
heid van een testverbinding en het bepalen voor elk polypeptide-ligand paar of de test-
verbinding binding tussen het geïmmobüiseerde polypeptide en de overeenkomstige
Ugand remt
30 [0142] De verscheidenheid is kenmerkend tenminste 5 en vaak tenminste 25 of
tenminste 40 verschülende PDZ-eiwitten. Ih een voorkeursuitvoeringsvorm zijn de ver-
scheidenheid van verschiüende Uganden en de verscheidenheid van verschülende PDZ-
eiwitten van hetzelfde weefsel of een specifieke klasse of soort van cel bijvoorbeeld
EU 1537 415 Bl
2.MAR.2009 15=21 NED. OCTROOIBUREAU 43703527580 NO.058 P.17
ACCOUNTS
73
een cervicale cel, een penis cel, een anale cel en dergeUjke. In een uitvoeringsvorm die
het meeste van voorkeur ïs, vertegenwoordigd de verscheidenheid van verschülende
PDZ's een aanzienlijke fractie (bijvoorbeeld tenminste 80%) van aUe van de PDZ's
waarvan bekend is of waarvan wordt vermoed dat ze tot expressie worden gebracht in
5 het weefsel of de cel(len), bijvoorbeeld aüe van de PDZ's waarvan bekend is dat ze
aanwezig zijn in lymfocyten (bijvoorbeeld tenminste 80%, tenminste 90% of alle van
de PDZ's die hierin zijn beschreven als tot expressie te worden gebracht in hematopoë-
tische ceUen).
[0143] In één uitvoeringsvorm wordt het rernmingsprofiel als volgt bepaald: Een
10 verscheidenheid (bijvoorbeeld aüe bekende) PDZ-domeinen die tot expressie worden
gebracht in een cel (bijvoorbeeld cervicale ceüen) worden tot expressie gebracht als
GST fusie-eiwitten en geïmmobüiseerd zonder de ügand-bindende eigenschappen er-
van te veranderen zoals hierboven is beschreven. Voor elk PDZ-domein wordt een ge-
merkt Ugand dat aan dit domein bindt met een bekende affiniteit geïdentificeerd. Indien
15 de set van PDZ-domeinen die tot expressie worden gebracht in lymfocyten wordt aan-
geduid door {Pl...Pn}, dan bindt elk bepaald PDZ-domein Pi een (gemerkt) ligand Li
met affiniteit Kdi. Voor het bepalen van het remmingsprofiel voor een testverbinding
"verbinding X" kan de "G" test (hierboven) als volgt worden uitgevoerd in platen met
96 putjes met rijen A-H en kolommen 1-12. Kolom 1 wordt bekleed met Pl en gewas-
20 sen. Het overeenkomstige Ugand Ll wordt toegevoegd aan elk gewassen bekleed putje
van kolom 1 bij een concentratie van 0,5 Kal met (rijen B, D, F, H) of zonder (rijen A,
C, E, F) tussen ongeveer 1 en ongeveer 1000 \iM) van testverbinding X. Kolom 2
wordt bekleed met P2 en L2 (bij een concentratie van 0,5 K<i2) wordt toegevoegd met
of zonder remmer X. AanvuUende PDZ-domeinen en Uganden worden op overeenkom-
25 stige wijze getest
[0144] Verbinding X wordt beschouwd de binding van Li aan Pi te remmen indien
het gemiddelde signaal in de putjes van kolom i die X bevat lager is dan de helft van
het signaal in de gelijkwaardige putjes van de kolom waarin X ontbreekt. In deze en-
kele test bepaalt men aldus de voUedige set van PDZ's van lymfocyten die worden ge-
30 remd door verbinding X.
[0145] Bij sommige uitvoeringsvormen is de testverbinding X een mengsel van
verbindingen, zoals het product van een combinatoriële chemische synthese zoals hier-
boven is beschreven, In sommige uitvoeringsvormen is het van de testverbinding be-
EU 1537 415 Bl
2.MAR.2009 15=21 NED. OCTROOIBUREAU 43703527580 NO.058 P.18
ACCOUNTS
74
kend dat het een gewenst biologisch effect heeft en wordt de test gebruikt voor het be-
palen van het mechanisme van werking (d.w.z. indien het biologische effect wordt ver-
oorzaakt door het moduleren van een PDZ-PL interactie).
[0146] Het zal duideUjk zijn dat een middel dat maar één of een paar PDZ-PL
5 interacties moduleert, in een paneel (bijvoorbeeld een paneel van aUe bekende PDZ's
van lymfocyten, een paneel van tenminste 10, tenminste 20 of tenminste 50 PDZ-do-
meinen) een meer specifieke modulator is dan een middel dat veel of de meeste inter-
acties moduleert. Een middel dat minder dan 20% van PDZ-domeinen in een paneel
moduleert (bijvoorbeeld Tabel 2) wordt kenmerkend beoordeeld als een "specifieke"
10 remmer, minder dan 6% als een "zeer specifieke" remmer en een enkel PDZ-domein
een "maximaal specifieke" remmer.
[0147] Het zal ook duideUjk zijn dat "verbinding X" een samenstelling kan zijn die
een mengsel van verbindingen bevat (bijvoorbeeld gegenereerd door het gebruik van
combinatoriële chemische werkwijzen) in plaats van een enkele verbinding.
15
Verscheidene variaties van deze test worden beschouwd:
[0148] In sommige alternatieve uitvoeringsvormen wordt de test van hierboven
uitgevoerd door het gebruik van variërende concentraties van de testverbinding X in
20 plaats van een vastgestelde concentratie. Dit maakt de bepaling mogelijk van de Ki van
de X voor elke PDZ zoals hierboven is beschreven.
[0149] In een alternatieve uitvoeringsvorm wordt in plaats van het vormen van
paren van elke PDZ-PL met een specifiek gemerkt Ugand Li, een mengsel van ver-
schülend gemerkte Uganden gevormd zodanig dat voor elke PDZ tenminste één van de
25 Uganden in het mengsel voldoende aan deze PDZ bindt om de binding in de "G" test te
detecteren. Dit mengsel wordt vervolgens gebruikt voor elk PDZ-domein.
[0150] In één uitvoeringsvorm is het van verbinding X bekend dat het een gewenst
biologisch effect heeft, maar het chemische mechanisme waardoor het dat effect heeft
is echter onbekend. De testen van de uitvinding kunnen vervolgens worden gebruikt om
30 te bepalen of verbinding X het effect ervan heeft door binding aan een PDZ-domein.
[0151] In één uitvoeringsvorm worden PDZ-domein-bevattende eiwitten geclassi-
ficeerd in groepen op basis van de biologische functie ervan, bijvoorbeeld in die welke
Chemotaxis reguleren versus die welke transcriptie reguleren. Een optimale remmer van
EU 1537 415 Bl
2.MAR.2009 15=22 NED. OCTROOIBUREAU 43703527580 NO.058 P.19
ACCOUNTS
75
een specifieke functie (bijvoorbeeld waaronder maar niet beperkt tot een anti-chemo-
tactisch middel, een anti-T-cel activatie middel, regulering van de celcyclus, transport
van vesicles, apoptose, enzovoort) zal meerdere PDZ-Ugand interacties die betrokken
zijn bij de functie (bijvoorbeeld Chemotaxis, activatie), maar weinig andere interacties,
5 remmen. De test wordt aldus gebruikt in één uitvoeringsvorm van het screenen en
ontwerpen van een geneesmiddel dat op specifieke wijze een specifieke functie
blokkeert. Een middel dat is ontworpen voor het blokkeren van Chemotaxis zou
bijvoorbeeld kunnen worden geïdentificeerd omdat het middel, bij een bepaalde con-
centratie, 2 of meer PDZ's die zijn betrokken bij Chemotaxis, maar minder dan 3 andere
10 PDZ's, remt of dat PDZ's die zijn betrokken bij Chemotaxis remt met een Ki > 10-vou-
dig beter dan voor andere PDZ's. De uitvinding verschaft aldus een werkwijze voor het
identificeren van een middel dat een eerste geselecteerde PDZ-PL interactie of een ver-
scheidenheid van interacties remt maar niet een tweede geselecteerde PDZ-PL interac-
tie of een verscheidenheid van interacties remt. De twee (of meer) sets van interacties
15 kunnen worden geselecteerd op basis van de bekende biologische functie van de PDZ-
domeinen, de weefselspecïficiteit van de PDZ-eiwitten of aüe andere criteria. De test
kan bovendien worden gebruikt voor het bepalen van de effectieve doses (d.w.z. con-
centratie van geneesmiddel) die resulteert in gewenste biologische effecten terwijl het
ongewenste effecten voorkomt.
20
C Agonisten en antagonisten van PDZ-PL interacties
[0152] Zoals hierin is beschreven kunnen interacties tussen PDZ-eiwitten en PL-
eiwitten in ceUen (bijvoorbeeld cervicale ceUen) worden ontwricht of worden geremd
25 door de aanwezigheid van pathogenen. Pathogenen kunnen worden geïdentificeerd
door het gebruik van screeningstesten die hierin zijn beschreven. Agonisten en antago-
nisten van PDZ-pathogene PL interacties of PDZ-ceUulaire PL interacties kunnen
bruikbaar zijn bij het maken van onderscheid of het bevestigen van specifieke interac-
ties. Bij sommige uitvoeringsvormen zal een agonist de gevoeUgheid van een PDZ-pa-
30 thogene PL interactie verhogen. Bij andere uitvoeringsvonnen kan een antagonist van
een PDZ-pathogene PL interactie worden gebruikt voor het bevestigen van de specifi-
citeit van een interactie. In één uitvoeringsvorm worden de motieven die hierin zijn
beschreven gebruikt voor het ontwerpen van remmers. In sommige uitvoeringsvormen
EU 1537 415 Bl
2.MAR.2009 15=22 NED. OCTROOIBUREAU 43703527580 NO.058 P.20
ACCOUNTS
76
hebben de antagonisten van de uitvinding een structuur (bijvoorbeeld peptidesequentie)
die is gebaseerd op de C-eindstandige residuen van PL-domein eiwitten die zijn opge-
somd in Tabel 3. In sommige uitvoeringsvormen hebben de antagonisten van de uitvin-
ding een structuur (bijvoorbeeld peptidesequentie) die is gebaseerd op een PL-motief
5 die hierin is beschreven of in Amerikaanse octrooi-aanvraag 09/724553.
[0153] De PDZ/PL antagonisten en antagonisten van de uitvinding kunnen elk van
een grote variëteit van verbindingen zijn, zowel natuurUjk voorkomend en synthetisch,
organisch en anorganisch en waaronder polymeren (bijvoorbeeld oügopeptiden, Poly-
peptiden, oUgonucleotiden en polynucleotiden), kleine moleculen, antilichamen, sui-
10 kers, vetzuren, nucleotiden en nucleotide-analoga, analoga van natuurlijk voorkomende
structuren (bijvoorbeeld peptide nabootsers, nucleïnezuur analoga en dergeUjke), en
talrijke andere verbindingen. Alhoewel de onderhavige beschrijving voor het gemak
voornameüjk verwijst naar antagonisten van PDZ-PL interacties, zal het duideUjk zijn
dat agonisten van de PDZ-PL interactie ook kunnen worden gebruikt bij de werkwijzen
15 die hierin zijn beschreven.
[0154] In één aspect bevatten de peptide en peptide nabootsers of analoga van de
uitvinding een aminozuursequentie die een PDZ-domein in een cel van belang bindt In
één uitvoeringsvorm omvatten de antagonisten een peptide dat een sequentie heeft die
overeenkomt met de carboxy-eindstandige sequentie van een PL-eiwit die is opgesomd
20 in Tabel 3 of in Amerikaanse octrooi-aanvraag 09/724553, bijvoorbeeld een peptide dat
is opgesomd in Tabel 3. Het peptide omvat kenmerkend tenminste de C-eindstandige
twee (2), drie (3) of vier (4) residuen van het PL-eiwit en vaak omvat het remmende
peptide meer dan vier residuen (bijvoorbeeld tenminste vijf, zes, zeven, acht, negen,
tien, twaalf of vijftien residuen) van het C-uiteinde van het PL-eiwit.
25 [0155] In sommige uitvoeringsvormen is de remmer een peptide dat bijvoorbeeld
een sequentie heeft van een C-eindstandige eiwitsequentie van een PL.
[0156] In sommige uitvoeringsvormen is de antagonist een fusie-eiwit dat een
dergeUjke sequentie omvat Fusie-eiwitten die een transmembraan transporter amino-
zuursequentie bevatten zijn in het bijzonder bruikbaar.
30 [0157] In sommige uitvoeringsvormen is de remmer een geconserveerde variant
van de C-eindstandige eiwitsequentie van PL die remmende activiteit heeft.
[0158] In sommige uitvoeringsvormen is de antagonist een peptide nabootser van
een C-eindstandige sequentie van PL.
EU 1537 415 Bl
2.MAR.2009 15=23 NED. OCTROOIBUREAU 43703527580 NO.058 P.21
ACCOUNTS
77
[0159] In sommige uitvoeringsvormen is de remmer een klein molecuul (d.w.z.
een molecuul dat een molecuulgewicht heeft van lager dan 1 kD).
D. Peptide antagonisten
5
[0160] In één uitvoeringsvorm omvatten de antagonisten een peptide dat een
sequentie heeft van een carboxy-uiteinde van een PL-eiwit die is opgesomd in Tabel 3.
Het peptide omvat tenminste de C-eindstandige twee (2) residuen van het PL-eiwit en
kenmerkend omvat het remmende peptide meer dan twee residuen (bijvoorbeeld ten-
10 minste drie, vier, vijf, zes, zeven, acht, negen, tien, twaalf of vijftien residuen) van het
C-uiteinde van het PL-eiwit. Het peptide kan elk van een verscheidenheid van lengten
hebben (bijvoorbeeld tenminste 2, tenminste 3, tenminste 4, tenminste 5, tenminste 6,
tenminste 8, tenminste 10, of tenminste 20 residuen) en kan aanvuUende residuen be-
vatten die niet van het PL-eiwit zijn. Het zal duideUjk zijn dat korte PL-peptiden soms
15 worden gebmikt bij het rationele ontwerp van andere kleine moleculen met overeen-
komstige eigenschappen.
[0161] Alhoewel het meest vaak worden de residuen die worden gedeeld door het
remmende peptide met het PL-eiwit gevonden aan het C-uiteinde van het peptide. In
sommige uitvoeringsvormen is de sequentie echter intern. Op overeenkomstige wijzen
20 omvat in sommige gevallen het remmende peptide residuen van een PL-sequentie die
in de nabijheid zijn, maar niet aan het C-uiteinde zijn van en PL-eiwit (zie Gee et al.,
1998, J Biological Chem. 273: 21980-87).
[0162] Soms wordt naar de sequentie van het carboxy-uiteinde van het PL-eiwit
verwezen als de "kern PDZ-motief sequentie" die verwijst naar het vermogen van de
25 korte sequentie om interactie te vertonen met het PDZ-domein. In een uitvoeringsvorm
bevat de "kem PDZ-motief sequentie" bijvoorbeeld de laatste vier C-eindstandige ami-
nozuren. Zoals hierboven is beschreven kan de kern van een PDZ-motief sequentie van
vier aminozuren aanvuUende aminozuren bevatten aan het amino-uiteinde ervan om de
bindingsaffiniteit en/of stabüiteit ervan verder te verhogen. In één uitvoeringsvonn kan
30 het peptide met de PDZ-motief sequentie aldus van vier aminozuren tot 15 aminozuren
zijn. Het is van voorkeur dat de lengte van de sequentie van 6-10 aminozuren is. Met
meer voorkeur bevat de PDZ-motief sequentie 8 aminozuren. AanvuUende aminozuren
aan het amino-eindstandige uiteinde van de kemsequentie kunnen afkomstig zijn van
EU 1537 415 Bl
2.MAR.2009 15=23 NED. OCTROOIBUREAU 43703527580 NO.058 P.22
ACCOUNTS
78
de natuurUjke sequentie in elke receptor van het oppervlak van de hematopoëtische cel
of een synthetische linker. De aanvuUende aminozuren kunnen ook op conservatieve
wijze zijn gesubstitueerd. Wanneer het derde residu van het C-uiteinde S, T of Y is, kan
dit residu worden gefosforyleerd voorafgaand aan het gebruik van het peptide.
5 [0163] In sommige uitvoeringsvormen zijn de peptide en niet-peptide remmers
klein, bijvoorbeeld minder dan tien aminozuurresiduen in lengte indien het een peptide
is. Het wordt verder vermeld dat een beperkt aantal van Ugand aminozuren op directe
wijze in contact staan met het PDZ-domein (in het algemeen minder dan acht) (Kozlov
et al., 2000, Biochemistry 39, 2572; Doyle et al., 1996, CeU 85, 1067) en dat peptiden
10 die zo kort zijn als de C-eindstandige drie aminozuren vaak overeenkomstige bindings-
eigenschappen behouden als peptiden met meer (>15) aminozuren (Yanagisawa et al.,
1997, J. Biol. Chem. 272, 8539).
15
E. Peptide varianten
[0164] Nu PDZ-bindende peptiden en PDZ-PL interactie remmende sequenties
zijn geïdentificeerd kunnen variaties van deze sequenties worden gemaakt en de resul-
terende peptide varianten kunnen worden getest op binding van het PDZ-domein of
PDZ-PL remmende activiteit. In uitvoeringsvormen hebben de varianten hetzelfde of
20 een verschülend vermogen om een PDZ-domein te binden als het ouderlijke peptide.
Dergelijke aminozuursubstituties zijn kenmerkend conservatief, iw.z. de aminozuur-
residuen worden vervangen met andere aminozuurresiduen die fysische en/of chemi-
sche eigenschappen hebben die overeenkomstig zijn aan de residuen die ze vervangen.
Conservatieve aminozuursubstituties zijn bij voorkeur die waarbij een aminozuur wordt
25 vervangen met een aminozuurresidu dat in dezelfde aangeduide klasse is opgenomen.
F. Peptide nabootsers
[0165] Nu PDZ-bindende peptiden en PDZ-PL interactie remmende sequenties
30 zijn geïdentificeerd kunnen peptide nabootsers worden bereid door het gebruik van
routine werkwijzen en de remmende activiteit van de nabootsers kan worden bevestigd
door het gebruik van de testen van de uitvinding. Bij sommige uitvoeringsvormen is de
agonist of antagonist aldus een peptide nabootser van een C-eindstandige sequentie van
EU 1537 415 Bl
2.MAR.2009 15=24 NED. OCTROOIBUREAU 43703527580 NO.058 P.23
ACCOUNTS
79
PL. Het zal voor de deskundige in het vakgebied duideUjk zijn dat afzonderiijke syn-
thetische residuen en Polypeptiden die nabootsers incorporeren kunnen worden gesyn-
thetiseerd door het gebruik van een verscheidenheid van werkwijzen en methodolo-
gieën die goed zijn beschreven in de wetenschappenüjke en octrooiüteratuur, bijvoor-
5 beeld Organic Syntheses CoUective Volumes, Gilman et al. (redacteuren) John Wiley
& Sons, me, NY. Polypeptiden die nabootsers incorporeren kunnen ook worden ge-
maakt door het gebruik van vaste fase synthesewerkwijzen, bijvoorbeeld zoals is be-
schreven door Di Mrchi et al., Amerikaans octrooischrift nummer 5.422,426. Naboot-
sers van de uitvinding kunnen ook worden gesynthetiseerd door het gebruik van com-
10 binatoriële werkwijzen. Verscheidene technieken voor het genereren van peptide en
peptide-nabootsende bibüotheken zijn goed bekend en omvatten bijvoorbeeld multipin,
tea bag en spUt-couple-mix technieken zie bijvoorbeeld al-Obeidi (1998) Mol. Biotech-
nol. 9: 205-223; Hruby (1997) Curr. Opin. Chem. Biol. 1: 114-119; Ostergaard (1997)
Mol. Divers. 3: 17-27; Ostresh (1996) Methods Enzymol. 267: 220-234.
15
G. Kleine moleculen
[0166] In sommige uitvoeringsvormen is de agonist of antagonist een klein mole-
cuul (d.w.z. die een molecuulgewicht heeft van minder dan 1 kD). Werkwijzen voor het
20 screenen op kleine moleculen zijn in het vakgebied goed bekend en omvatten die welke
hierboven zijn beschreven,
X. Werkwijzen voor het optimalseren van een PL detector
25 [0167] Alhoewel het hierboven voornameüjk is beschreven in termen van het
identificeren van interacties tussen PDZ-domein Polypeptiden en PL-eiwitten, kunnen
de testen die hierboven zijn beschreven en andere testen ook worden gebruikt voor het
identificeren van de binding van andere moleculen (bijvoorbeeld peptide nabootsers,
kleine moleculen en dergeUjke) aan sequenties van PDZ-domeinen. Door het gebruik
30 van de testen die hierin zijn beschreven kunnen bijvoorbeeld combinatorièle en andere
bibliotheken van verbindingen worden gescreend bijvoorbeeld op moleculen die op
specifieke wijze binden aan PDZ-domeinen. Screening van bibüotheken kan worden
volbracht door elk van een verscheidenheid van algemeen bekende werkwijzen. Zie
EU 1537 415 Bl
2.MAR.2009 15=24 NED. OCTROOIBUREAU 43703527580 NO.058 P.24
ACCOUNTS
80
bijvoorbeeld de volgende referenties die de screening van peptidebibUotheken beschrij-
ven: Parmley en Smith, 1989, Adv. Exp- Med. Biol. 251: 215-218; Scott en Smith,
1990, Science 249: 386-390; Fowlkes et al., 1992; BioTechniques 13: 422- 427;
Oldenburg et al., 1992, Proc. Natl. Acad. Sei. USA 89: 5393-5397; Yu et al., 1994, Cell
5 76: 933-945; Staudt et al., 1988, Science 241: 577-580; Bock et al., 1992, Nature 355:
564- 566; Tuerk et al., 1992, Proc, Natl. Acad. Sei. USA 89: 6988-6992; EUington et
al? 1992, Nature 355: 850-852; Amerikaans octrooischriftnummer 5.096.815, Ameri-
kaans octrooischriftnummer 5.223.409 en Amerikaans octrooischriftnummer
5.198.346, aüe volgens Ladner et al.; Rebar en Pabo, 1993, Science 263: 671-673; en
10 PCT Publicatienummer WO 94/18318.
[0168] In een specifieke uitvoeringsvorm kan screening worden uitgevoerd door
het in contact brengen van de leden van de bibliotheek met een PDZ-domein polypep-
tide dat is geïmmobiliseerd aan een vaste drager (bijvoorbeeld zoals hierboven is be-
schreven in de "G" test) en het oogsten van die leden van de bibüotheek die aan het
15 eiwit binden. Voorbeelden van dergeUjke screeningswerkwijzen, genaamd "panning"
technieken zijn bij wijze van voorbeeld beschreven in Parmley en Smith, 1988, Gene
73: 305-318; Fowlkes et al., 1992, BioTechniques 13:422427; PCT Publicatienummer
WO 94/18318; en in referenties die hierin hierboven zijn geciteerd.
[0169] In een andere uitvoeringsvonn kan het twee-hybride systeem voor het
20 selecteren van interactie vertonende eiwitten in gist (Fields en Song, 1989, Nature 340:
245-246; Chien et al., 1991, Proc. Natl. Acad. Sei. USA 88: 9578-9582) worden ge-
bruikt voor het identificeren van moleculen die op specifieke wijze binden aan een
PDZ-domein-bevattend eiwit De geïdentificeerde moleculen worden verder getest op
het vermogen ervan om transmembraanreceptor interacties met een PDZ-domein te
25 remmen.
[0170] In één aspect van de uitvinding worden antagonisten van een interactie tus-
sen een PDZ-domein en een PL-eiwit geïdentificeerd. Ih één uitvoeringsvorm wordt
een modificatie van de "A" test die hierboven is beschreven gebruikt voor het identifi-
ceren van antagonisten. In één uitvoeringsvorm wordt een modificatie van de "G" test
30 die hierboven is beschreven gebruikt voor het identificeren van antagonisten.
[0171] Ih één uitvoeringsvorm worden screeningstesten gebruikt voor het detecte-
ren van moleculen die op specifieke wijze binden aan PDZ-domeinen. DergeUjke mo-
leculen zijn bruikbaar als agonisten of antagonisten voor PDZ-domein-bemiddelde cel-
EU 1537 415 Bl
2.MAR.2009 15=25 NED. OCTROOIBUREAU 43703527580 NO.058 P.25
ACCOUNTS
81
functie (bijvoorbeeld celactivatie, bijvoorbeeld T-cel activatie, vesicle transport, cyto-
kine afgifte, groeifactoren, transcriptionele veranderingen, herrangschüdringen van het
cytoskelet, celbeweging, Chemotaxis en dergeUjke). In één uitvoeringsvorm worden
dergeUjke testen uitgevoerd voor het screenen op remmers van leukocyt activatie voor
5 ontwikkeling van geneesmiddelen, De uitvinding verschaft aldus testen voor het detec-
teren van moleculen die op specifieke wijze binden aan PDZ-domein-bevattende ei-
witten. Recombinante cellen die voor PDZ-domein coderende nucleïnezuren tot ex-
pressie brengen kunnen bijvoorbeeld worden gebruikt voor het produceren van PDZ-
domeinen in deze testen en om te screenen op moleculen die aan de domeinen binden.
10 Moleculen worden in contact gebracht met het PDZ-domein (of fragment daarvan) on-
der omstandigheden die zijn geïdentificeerd. Werkwijzen die kunnen worden gebruikt
voor het uitvoeren van het voorgaande zijn algemeen bekend in het vakgebied.
[0172] Het zal duideUjk zijn voor de deskundige in het vakgebied dat in één
uitvoeringsvorm antagonisten worden geïdentificeerd door het uitvoeren van de A- of
15 G-testen in de aanwezigheid of afwezigheid van een bekende of gegadigde antagonist
Wanneer afnemende binding wordt waargenomen in de aanwezigheid van een verbin-
ding wordt die verbinding geïdentificeerd als een antagonist. Verhoogde binding in de
aanwezigheid van een verbinding geeft aan dat de verbinding een agonist is.
[0173] In één test kan een testverbinding bijvoorbeeld worden geïdentificeerd als
20 een remmer (antagonist) van binding tussen een PDZ-eiwit en een PL-eiwit door een
PDZ-domein polypeptide en een PL-peptide in contact te brengen in de aanwezigheid
en afwezigheid van de testverbinding, onder omstandigheden waarbij ze een complex
zouden (behalve in de aanwezigheid van de testverbinding) vormen en het detecteren
van de vorming van het complex in de aanwezigheid en afwezigheid van de testverbin-
25 ding. Het zal duideUjk zijn dat minder vorming van complex in de aanwezigheid van de
testverbinding dan in de afwezigheid van de verbinding aangeeft dat de testveihinding
een remmer is van een binding van een PDZ-eiwit PL-eiwit.
[0174] In één uitvoeringsvonn wordt de "G" test gebruikt in de aanwezigheid en
afwezigheid van een gegadigde remmer. In één uitvoeringsvorm wordt de "A" test ge-
30 bruikt in de aanwezigheid of afwezigheid van een gegadigde remmer.
[0175] In één uitvoeringsvorm (waarbij een G-test wordt gebruikt) worden één of
meer PDZ-domein-bevattende GST-fusie-eiwitten gebonden aan het oppervlak van
putjes van een plaat met 96 putjes zoals hierboven is beschreven (met juiste controles
EU 1537 415 Bl
2.MAR.2009 15:26 NED. OCTROOIBUREAU 43703527580 NO.058 P.26
ACCOUNTS
82
waaronder niet-fusie GST-eiwit). AUe fusie-eiwitten worden gebonden in meerdere
putjes zodat juiste controles en statistische analyse kunnen worden uitgevoerd. Een
testverbinding in BSA/PBS (kenmerkend bij meerdere verschülende concentraties)
wordt aan putjes toegevoegd. Direct daarna wordt 30 nl van een detecteerbaar gemerkt
5 (bijvoorbeeld gebiotinyleerd) peptide waarvan bekend is dat het bindt aan het relevante
PDZ-domein (zie bijvoorbeeld Tabel 4) aan elk van de putjes toegevoegd bij een uit-
eindeüjke concentratie van bijvoorbeeld tussen ongeveer 2 nM en ongeveer 40 |xM,
kenmerkend 5 nM, 15 nM, of 25 uM. Dit mengsel wordt vervolgens toegestaan gedu-
rende 10 minuten bij 4°C gevolgd door 20 minuten bij 25°C te reageren met het PDZ
10 fusie-eiwit dat is gebonden aan het oppervlak. Het oppervlak wordt drie keer gewassen
met ijskoude PBS zodat het vrij is van ongebonden peptiden en de hoeveelheid van
binding van het peptide in de aanwezigheid en afwezigheid van de testverbinding wordt
bepaald. Het niveau van binding wordt gewoonUjk gemeten voor elke set van putjes in
kopiën (bijvoorbeeld duplo's) door het aftrekken van de gemiddelde achtergrond van
15 aüeen GST van het gemiddelde van de ruwe meting van peptidebinding in deze putjes.
[0176] In een alternatieve uitvoeringsvorm wordt de A-test uitgevoerd in de
aanwezigheid en afwezigheid van een te testen gegadigde voor het identificeren van
remmers van de PL-PDZ interactie.
[0177] In één uitvoeringsvorm wordt een testverbinding bepaald een specifieke
20 remmer van de binding van het PDZ-domein (P) en een PL (L) sequentie te zijn wan-
neer, bij een concentratie van de testverbinding van lager dan of geüjk aan 1 mM (bij-
voorbeeld lager of geüjk aan; 500 nM, 100 uM, 10 nM, 1 nM, 100 nM of 1 nM) de
binding van P aan L in de aanwezigheid van de testverbinding lager is dan ongeveer
50% van de binding in de afwezigheid van de testverbinding. (in verscheidene uitvoe-
25 ringsvormen lager dan ongeveer 25%, lager dan ongeveer 10% of lager dan ongeveer
1 %). Het netto signaal van binding van P aan L in de aanwezigheid van de testverbin-
ding plus zes (6) keer de standaardfout van het signaal in de aanwezigheid is bij voor-
keur lager dan het signaal van binding in de afwezigheid van de testverbinding.
[0178] In één uitvoeringsvorm worden testen op een remmer uitgevoerd door het
30 gebruik van een enkel PDZ-eiwit - PL-eiwit paar (bijvoorbeeld een PDZ-domein fusie-
eiwit en een PL-peptide). Ih een verwante uitvoeringsvorm worden de testen uitgevoerd
door het gebruik van een verscheidenheid van paren, zoals een verscheidenheid van
verschülende paren die zijn opgesomd in Tabel 4.
EU 1 537 415 Bl
2.MAR.2009 15:26 NED. OCTROOIBUREAU 43703527580 NO.058 P.27
ACCOUNTS
83
[0179] In sommige uitvoeringsvormen is het gewenst om verbindingen te
identificeren die, bij een bepaalde concentratie, de binding van één PL-PDZ paar rem-
men maar niet de binding van een gespecificeerd tweede PL-PDZ paar remmen (of in
een mindere mate remmen). Deze antagonisten kunnen worden geïdentificeerd door het
5 uitvoeren van een serie van testen door het gebruik van een gegadigde remmer en ver-
schillende PL-PDZ paren (bijvoorbeeld zoals is getoond in de matrix van Tabel 4) en
het vergeüjken van de resultaten van de testen. Al dergeUjke paarsgewijze combinaties
worden beschouwd door de uitvinding (bijvoorbeeld de testverbinding remt binding
van PLi aan PDZi in een sterkere mate dan dat het binding van PLi aan PDZ2 of PL2
10 aan PDZ2 remt). Van belang zal het duideUjk zijn dat op basis van de gegevens die zijn
verschaft in Tabel 4 en die hierin zijn beschreven (en aanvuUende gegevens die kunnen
worden gegenereerd door het gebruik van de werkwijzen die hierin zijn beschreven) dat
remmers met verschülende specificiteiten eenvoudig kunnen worden ontworpen.
[0180] Volgens de uitvinding kan de Ki ("sterkte") van een remmer van een PDZ-
15 PL interactie worden bepaald. Ki is een maat voor de concentratie van een remmer die
nodig is om een biologisch effect te hebben. Toediening van een remmer van een PDZ-
PL interactie bij een hoeveelheid die voldoende is om te resulteren in een intracellulaire
concentratie van remmer van tenminste tussen ongeveer 1 en ongeveer 100 Ki wordt
bijvoorbeeld verwacht de biologische respons die wordt bemiddeld door de PDZ-PL
20 interactie die het doelwit is, te remmen. In één aspect van de uitvinding wordt de Kd
meting van binding van PDZ-PL zoals wordt bepaald door het gebruik van de werkwij-
zen hierboven gebruikt voor het bepalen van Ki,
[0181] In één aspect verschaft de uitvinding aldus een werkwijze voor het bepalen
van de sterkte (Ki) van een remmer of vermoede remmer van binding tussen een PDZ-
25 domein en een Ugand door het immobüiseren van een polypeptide dat het PDZ-domein
en een niet-PDZ-domein omvat op een oppervlak, het in contact brengen van het ge-
immobüiseerde polypeptide met een verscheidenheid van verschülende mengsels van
het Ugand en remmer, waarbij de verschülende mengsels een vastgestelde hoeveelheid
van het ligand en verschillende concentraties van de remmer omvatten, het bepalen van
30 de hoeveelheid van Ugand die is gebonden bij de verschülende concentraties van rem-
mer en het berekenen van de Ki van de binding op basis van de hoeveelheid van Ugand
dat is gebonden in de aanwezigheid van verschülende concentraties van de remmer. In
een uitvoeringsvorm is het polypeptide geïmmobüiseerd door binding van het polypep-
EU 1537 415 Bl
2.MAR.2009 15:27 NED. OCTROOIBUREAU 43703527580 NO.058 P.28
ACCOUNTS
84
tide aan een geïmmobüiseerde immunoglobuline dat het niet-PDZ-domein bindt Deze
werkwijze, die is gebaseerd op de "G" test die hierboven is beschreven, is in het bij-
zonder geschikt voor analyse bij hoge doorvoer van de Ki voor remmers van de PDZ-
Ugand interacties. Door het gebruik van deze werkwijze wordt verder de remming van
5 de PDZ-Ugand interactie zelf gemeten zonder storende invloed van metingen door ef-
fecten van aviditeit
[0182] Kenmerkend is tenminste een deel van het Ugand detecteerbaar gemerkt
voor het mogeüjk maken van eenvoudige kwantificering van binding van Ugand.
[0183] Het zal duideUjk zijn dat de concentratie van ligand en concentraties van
10 remmer worden geselecteerd om betekenisvoUe detectie van remming mogeUjk te ma-
ken. De concentratie van het Ugand waarvan de binding moet worden geblokkeerd is
aldus bijna hetzelfde of lager dan de affiniteit van binding ervan (bijvoorbeeld bij voor-
keur lager dan de 5x Kd van de interactie, met meer voorkeur lager dan 2x Kd, met
meeste voorkeur lager dan lx Kd). Het Ugand is aldus kenmerkend aanwezig bij een
15 concentratie van lager dan 2 Kd (bijvoorbeeld tussen ongeveer 0,01 Kd en ongeveer 2
Kd) en de concentraties van de te testen remmer variëren kenmerkend van 1 nM tot 100
nM (bijvoorbeeld een 4-voudige verdunningserie met hoogste concentratie van 10 nM
of 1 mM). In een voorkeursuitvoeringsvorm wordt de Kd bepaald door het gebruik van
de test die hierboven is beschreven.
20 [0184] De Ki van de binding kan worden berekend door eUc van een verscheiden-
heid van werkwijzen die op routine wijze in het vakgebied worden gebruikt, op basis
van de hoeveelheid ligand die is gebonden in de aanwezigheid van verschiUende con-
centraties van de remmer. In een ülustratieve uitvoeringsvorm wordt bijvoorbeeld een
grafiek van binding van gemerkt Ugand versus concentratie remmer aangepast aan de
25 vergeUjking:
Sremraer=So*Ki/([I]+Ki)
waarbij Summer het signaal is van binding van gemerkt ligand aan geïmmobiliseerd
30 PDZ-domein in de aanwezigheid van remmer bij concentratie [fj en S0 het signaal is in
de afwezigheid van remmer (d.w.z. [I] = 0). Kenmerkend wordt [I] uitgedrukt als een
molaire concentratie.
EU 1537 415 Bl
2.MAR.2009 15:27 NED. OCTROOIBUREAU 43703527580 NO.058 P.29
ACCOUNTS
85
[0185] In een ander aspect van de uitvinding wordt een versterker (soms naar
verwezen als een verhoger of agonist) van binding tussen een PDZ-domein en een ü-
gand geïdentificeerd door het immobiUseren van een polypeptide dat het PDZ-domein
en een niet-PDZ-domein omvat op een oppervlak, het in contact brengen van het ge-
5 immobüiseerde polypeptide met het Ugand in de aanwezigheid van een testmiddel en
het bepalen van de hoeveelheid van gebonden Ugand en het vergeüjken van de hoe-
veelheid van gebonden Ugand in de aanwezigheid van een testmiddel met de hoeveel-
heid van Ugand gebonden door het polypeptide in de afwezigheid van het testmiddel.
Tenminste tweevoudige (vaak tenminste 5-voudige) hogere binding in de aanwezigheid
10 van het testmiddel in vergeUjking met de afwezigheid van testmiddel geeft aan dat het
testmiddel een middel is dat de binding van het PDZ-domein aan het Ugand verhoogd.
Zoals hierboven is opgemerkt zijn middelen die de interacties van PDZ-Ugand verho-
gen bruikbaar voor het ontwrichten (dysreguleren) van biologische gebeurtenissen die
normale PDZ-Ugand functie vereisen (bijvoorbeeld deling en métastase van kankercel-
15 len en activering en migratie van immuunceUen).
[0186] De uitvinding verschaft ook werkwijzen voor het bepalen van de "sterkte"
of "Kverstaker" van een versterker van een PDZ-Ugand interactie. Volgens de uitvinding
kan bijvoorbeeld de Kveratokcr van een versterker van een PDZ-PL interactie worden
bepaald door het gebruik van bijvoorbeeld de Kd van binding van PDZ-PL zoals is be-
20 paald door het gebruik van de werkwijzen die hierboven zijn beschreven. KV6i3t«kcr is
een maat van de concentratie van een versterker waarvan wordt verwacht dat het een
biologisch effect heeft. Toediening van een versterker van een PDZ-PL interactie bij
een hoeveelheid die voldoende is om te resulteren in een intraceUulaire concentratie
van remmer van tenminste tussen ongeveer 0,1 en ongeveer 100 Kvasteà^i (bijvoorbeeld
25 tussen ongeveer 0,5 en ongeveer 50 Kv^tc*«) wordt verwacht de biologische respons
die wordt bemiddeld door de interactie van PDZ-PL die het doelwit is te ontwrichten.
[0187] In één aspect verschaft de uitvinding aldus een werkwijze voor het bepalen
van de sterkte (K^mfe) van een versterker of vermoede versterker van binding tussen
een PDZ-domein en een Ugand door het immobüiseren van een polypeptide dat het
30 PDZ-domein en een niet-PDZ-domein omvat op een oppervlak, het in contact brengen
van het geïmmobüiseerde polypeptide met een verscheidenheid van verschülende
mengsels van Ugand en versterker, waarbij de verschülende mengsels een vastgestelde
hoeveelheid van Ugand, waarvan tenminste een deel op detecteerbare wijze is gemerkt,
EU 1537 415 Bl
2.MAR.2009 15:28 NED. OCTROOIBUREAU 43703527580 NO.058 P.30
ACCOUNTS
86
en verschülende concentraties van de versterker omvat het bepalen van de hoeveelheid
Ugand die is gebonden bij de verschülende concentraties van versterker en het bereke-
nen van de sterkte (Kvcretaker) van de versterker van de binding op basis van de hoeveel-
heid van Ugand die is gebonden in de aanwezigheid van verschülende concentraties van
5 de versterker. Tenminste een deel van het Ugand is kenmerkend detecteerbaar gemerkt
voor het mogeUjk maken van de eenvoudige kwantificering van binding van Ugand.
Deze werkwijze die is gebaseerd op de "G" test die hierboven is beschreven, is in het
bijzonder geschikt voor analyse bij hoge doorvoer van de Kveraled_T voor versterkers van
de interacties van PDZ-Ugand.
10 [0188] Het zal duideUjk zijn dat de concentratie van Ugand en concentraties van
versterker worden geselecteerd om een betekenisvoüe detectie van verhoogde binding
mogeUjk te maken. Het Ugand is aldus kenmerkend aanwezig bij een concentratie van
tussen ongeveer 0,01 Kd en ongeveer 0,5 kD en de concentraties van het te testen mid-
del/versterker variëren kenmerkend van 1 nM tot 1 mM (bijvoorbeeld een 4-voudige
15 verdunningsserie met hoogste concentratie van 10 |iM of 1 mM). In een voorkeursuit-
voeringsvorm wordt de Kd bepaald door het gebruik van de test die hierboven is be-
schreven.
[0189] De sterkte van de binding kan worden bepaald door een verscheidenheid
van standaardwerkwijzen die zijn gebaseerd op de hoeveelheid Ugand die wordt gebon-
20 den in de aanwezigheid van verschülende concentraties van de versterker of verhogen
Een grafiek van binding van gemerkt ligand versus concentratie van versterker kan bij-
voorbeeld worden aangepast aan de vergeUjking:
25
S([E]) = S(0) + (S^tDv^edcerl^l^Ej+Kv^er)
waarbij "Kv_st_ker" de sterkte van de versterkende verbinding is en "Dvomciker" de veel-
voud van toename in binding is van het gemerkte Ugand die is verkregen met toevoe-
ging van verzadigende hoeveemeden van de versterkende verbinding, [E] de concen-
tratie van de versterker is. Het zal duidelijk zijn dat verzadigende hoeveelheden de
30 hoeveelheid van versterker is die zodanig is dat verdere toevoeging niet aanzienlijk het
signaal van binding verhoogt. Kennis van de "KveEW is bruikbaar omdat bet een
concentratie beschrijft van de versterkende verbinding in een doelwitcel die zal resulte-
EU 1537 415 Bl
2.MAR.2009 15=37 NED. OCTROOIBUREAU 43703527580 NO.059 P.2"
ACCOUNTS
87
ren in een biologisch effect door dysregulatie van de interactie van PDZ-PL. Kenmer-
kende therapeutische concentraties zijn tussen ongeveer 0,1 en ongeveer 100 KveiSt_?er-
[0190] Voor bepaalde van de PDZ-eiwitten en PL-eiwitten waarvan is getoond dat
ze tezamen binden en waarvoor Kd-waarden zijn verkregen, werden aanvuUende testen
5 uitgevoerd om te bepalen of bepaalde farmaceutische verbindingen zouden werken om
de interacties tegen te werken ofte stimuleren. Testen werden uitgevoerd zoals voor de
G'-test die hierboven is beschreven, zowel in de aanwezigheid en de afwezigheid van
testverbinding behalve dat 50 ul van een oplossing van 10 nM van het gebiotinyleerde
PL-peptide mogeUjk wordt gemaakt om te reageren met het oppervlak dat het PDZ-
10 domein polypeptide draagt in plaats van een 20 nM oplossing zoals is gespecificeerd in
stap (2) van de test.
[0191] Een andere werkwijze voor het verhogen van de specificiteit of gevoeUg-
heid van een PDZ-PL interactie is door mutagénèse en selectie van varianten met hoge
affiniteit of hoge specificiteit. Werkwijzen zoals UV, chemische (bijvoorbeeld EMS) of
15 biologische mutagénèse (bijvoorbeeld moleculaire herverdeling of DNA-polymerase
mutagénèse) kunnen worden toegepast voor het vormen van mutaties in DNA dat co-
deert voor PDZ-domeinen of PL-domeinen. Eiwitten kunnen vervolgens van varianten
worden gemaakt en worden getest door het gebruik van een aantal werkwijzen die
hierin zijn beschreven (bijvoorbeeld "A" test, "G" test of gist twee hybride). In het al-
20 gemeen zou men mutanten testen op binding met hoge affiniteit tussen het gemuteerde
PDZ-domein en een testmonster (zoals een oncogene E6 PL) die verlaagde affiniteit
hebben voor andere ceUulaire PL's (zoals is beschreven in deel IX). Deze werkwijzen
zijn bij de deskundigen in het vakgebied bekend en voorbeelden hierin zijn niet bedoeld
beperkend te zijn.
25
XI. Synthese van recombinante detector
[0192] Zoals is aangegeven in het deel van de Achtergrond zijn PDZ-domein-
bevattende eiwitten betrokken bij een aantal van biologische functies waaronder, maar
30 niet beperkt tot vesiculair transport, tumor onderdrukking, eiwitsortering, handhaving
van membraanpolariteit, apoptose, regulering van immuunrespons en organisatie van
vorming van Synapsen. Deze famüie van eiwitten heeft in het algemeen een algemene
functie van het bewerkstelügen van de verzameling van multi-eiwit complexen die
EU 1537 415 Bl
2.MAR.2009 15=38 NED. OCTROOIBUREAU 43703527580 NO.059 P.3"
ACCOUNTS
88
vaak dienen als een brug tussen verscheidene eiwitten of het reguleren van de functies
van andere eiwitten. In aanvulling, zoals hierboven is opgemerkt, worden deze eiwitten
in wezen in aüe soorten van cellen gevonden. Als gevolg kan detectie van onjuiste
PDZ-PL interacties of abnormale interacties worden gebruikt voor het diagnosticeren
van een brede variëteit van biologische en fysiologische aandoeningen. Detectie van
PL-eiwitten van pathogène organismen kan in het bijzonder worden gediagnosticeerd
door het gebruik van PDZ-domeinen. De meeste, maar niet aüe, uitvoeringsvormen van
deze uitvinding vereisen de toevoeging van een detecteerbare merker aan het PDZ- of
PL-eiwit dat wordt gebruikt voor detectie. Voorbeelden worden hieronder gegeven.
10
A. Chemische synthese
[0193] De peptiden van de uitvinding of analoga daarvan kunnen worden bereid
door het gebruik van in feite elke in het vakgebied bekende techniek voor de bereiding
15 van peptide en peptide-analoga. De peptiden kunnen bijvoorbeeld worden bereid in
Uneaire vorm door het gebruik van gebruikeUjke peptidesynthese in oplossing aan vaste
fase en van de hars worden gesplitst gevolgd door zuiveringswerkwijzen (Creighton,
1983, Protein Structures And Molecular Principles, W,H Freeman and Co., N.Y. ).
Geschikte werkwijzen voor het synthetiseren van de peptiden die hierin zijn beschreven
20 zijn in het vakgebied goed bekend. De samenstelüng van de synthetische peptiden kan
worden bevestigd door aminozuuranalyse of sequentie-analyse (bijvoorbeeld de Edman
degradatie werkwijze en massaspectrometrie).
[0194] In aanvulling kunnen analoga en derivaten van de peptiden op chemische
wijze worden gesynthetiseerd. De koppeUng tussen elk aminozuur van de peptiden van
25 de uitvinding kan een amide, een gesubstitueerde amide of een isosteer van amide zijn.
Niet-klassieke aminozuren of chemische aminozuur analoga kunnen worden geïntrodu-
ceerd als een substitutie of toevoeging in de sequentie. Niet-klassieke aminozuren om-
vatten, maar zijn niet beperkt tot, de D-isomeren van de algemene aminozuren, a-
amino-isoboterzuur, 4-aminoboterzuur, Abu, 2-aminoboterzuur, y-Abu, e-Ahx, 6-
30 arnino-hexaanzuur, Aib, 2-amino-isoboterzuur, 3-aminopropionzuur, ornithine, norleu-
cine, norvaline, hydroxyproüne, sarcosine, citrulüne, cystemezuur, t-butylglycine, t-
butylalanine, fenylglycine, cyclohexylalanine, ß-alanine, fluor-aminozuren, ontworpen
aminozuren zoals ß-memylaminozuren, Ca-methylaminozuren, Na-methyl-aminozuren
EU 1537 415 Bl
2.MAR.2009 15=38 NED. OCTROOIBUREAU 43703527580 NO.059 P.4
ACCOUNTS
89
en aminozuuranaloga in het algemeen. Het aminozuur kan bovendien D (dextro-rote-
rend) of L (laevo-roterend) zijn.
B. Recombinante synthese
5
[0195] Indien het peptide geheel is samengesteld uit gen-gecodeerde aminozuren
of een deel ervan is zodanig samengesteld, kan het peptide of het relevante deel ook
worden gesynthetiseerd door het gebruik van gebruikeüjke recombinante technieken
van genetische manipulatie. Voor recombinante productie wordt een polynucleotide-
10 sequentie die codeert voor een lineaire vorm van het peptide geïnsereerd in een ge-
schikt hulpmiddel voor expressie, d.w.z. een vector die de noodzakeüjke elementen
voor de transcriptie en translatie van de gemsereerde coderende sequentie bevat of, in
het geval van een RNA virale vector, de noodzakeüjke elementen voor repUcatie en
translatie. Het hulpmiddel voor expressie wordt vervolgens getransfecteerd in een ge-
15 schikte doelwitcel die het peptide tot expressie brengt. AfhankeUjk van het expressie-
systeem dat wordt gebruikt wordt het tot expressie gebrachte peptide vervolgens geï-
soleerd door werkwijzen die in het vakgebied goed zijn vastgelegd. Werkwijzen voor
recombinante productie van eiwit en peptide zijn in het vakgebied goed bekend (zie
bijvoorbeeld Maniatis et al., 1989, Molecular Cloning A Laboratory Manual, Cold
20 Spring Harbor Laboratory, N. Y.; en Ausubel et al., 1989, Current Protocols in Mole-
cular Biology, Greene PubUshing Associates and Wüey Ihterscience, N.Y.),
[0196] Een verscheidenheid van gastheer-expressievector systemen kunnen wor-
den gebruikt voor het tot expressie brengen van de peptiden die hierin zijn beschreven.
Deze omvatten, maar zijn niet beperkt tot, micro-organismen zoals bacteriën die zijn
25 getransformeerd met recombinant bacteriofaag DNA of plasmide DNA expressievecto-
ren die een juiste coderende sequentie bevatten; gist of filamenteuze schimmels die zijn
getransformeerd met recombinante expressievectoren voor gist of schimmel die een
geschikte coderende sequentie bevatten; systemen van insectenceüen die zijn geïnfec-
teerd met recombinante expressievectoren in de vorm van virussen (bijvoorbeeld ba-
30 culovirus) die een juiste coderende sequentie bevatten; plantencelsystemen die zijn ge-
ïnfecteerd met recombinante expressievectoren in de vorm van virussen (bijvoorbeeld
bloemkoolmozaïekvirus of tabaksmozaïekvirus) of zijn getransformeerd met recombi-
EU 1537 415 Bl
2.MAR.2009 15=39 NED. OCTROOIBUREAU 43703527580 NO.059 P.5
ACCOUNTS
90
nante plasmide expressievectoren (bijvoorbeeld Ti plasmide) die een juiste coderende
sequentie bevatten; of dierüjke cel systemen.
[0197] In sommige uitvoeringsvormen kan het verhogen van het aantal kopieën
van een PL detector worden gebruikt voor het verhogen van de specificiteit of de ge-
5 voeügheid van detectie, Een voorbeeld hiervan is getoond in Voorbeeld 4. De TIP-TIP-
IgG vector produceert een fusie-eiwit dat gedupüceerde kopieën van het PDZ-domein
van TDM heeft en het eiwit zelf zou moeten dimeriseren op de basis van het skelet van
het constante gebied van de IgG. Een enkel eiwit bevat aldus 2-4 kopieën van het TIP-1
PDZ-domein. Op een overeenkomstige wijze zou toevoeging van achter elkaar ge-
10 plaatste herhalingen van PL detectoren kunnen worden gemaakt Li sommige uitvoe-
ringsvormen zouden verschülende PDZ-domeinen van verschülende eiwitten kunnen
worden gemanipuleerd om het als een enkel eiwit tot expressie te brengen (bijvoor-
beeld de PDZ-domeinen van TIP-1 en MAGI-1 kunnen worden gemanipuleerd voor het
detecteren van oncogene HPV E6 eiwitten). Op een overeenkomstige wijze zou een
15 ander Ig skelet kunnen worden gebruikt voor het verhogen van de aviditeit van een
construct. De IgG constante gebieden zuUen bijvoorbeeld met zichzelf dimeriseren
maar de IgM constante gebieden zullen een complex van tien monomeren vormen.
[0198] De expressie-elementen van de expressievectoren variëren in de sterkte en
specificiteiten ervan. AfhankeUjk van het gastheer/vector systeem dat wordt gebruikt
20 kan elk van een aantal van geschikte transcriptie en translatie-elementen, waaronder
constitutieve en induceerbare promoters, worden gebruikt in de expressievector. Wan-
neer in bacteriële systemen wordt gekloneerd kunnen bijvoorbeeld induceerbare pro-
moters zoals pL van bacteriofaag X, plac, ptrp, ptac (ptrp-lac hybride promoter) en der-
geUjke worden gebruikt; wanneer wordt gekloneerd in insectencelsystemen kunnen
25 promoters zoals de polyhedron promoter van baculovirus worden gebruikt; wanneer
wordt gekloneerd in plantencelsystemen kunnen promoters die afkomstig zijn van het
genoom van plantenceUen (bijvoorbeeld heat-shock promoters; de promoter voor de
kleine subeenheid van RUBISCO; de promoter voor het chlorofyü a/b bindende eiwit)
of van plantenvirussen (bijvoorbeeld de 35S RNA promoter van CaMV; de promoter
30 van het manteleiwit van TMV) worden gebruikt; wanneer wordt gekloneerd in zoog-
dierüjke celsystemen kunnen promoters die afkomstig zijn van het genoom van zoog-
dierüjke ceüen (bijvoorbeeld metaüothioneïne promoter) of van zoogdierüjke virussen
(bijvoorbeeld de late promoter van het adenovirus; de 7,5 K promoter van vacciniavi-
EU 1537 415 Bl
2.MAR.2009 15=39 NED. OCTROOIBUREAU 43703527580 NO.059 P.6
ACCOUNTS
91
rus) worden gebruikt; wanneer ceUijnen worden gegenereerd die meerdere kopieën van
expressieproduct bevatten kunnen SV40-, BPV- en EBV-gebaseerde vectoren worden
gebruikt met een geschikte selecteerbare merker.
[0199] Ih gevaUen waarbij expressievectoren voor planten worden gebruikt kan de
5 expressie van sequenties die coderen voor de peptiden van de uitvinding worden aange-
stuurd door elk van een aantal van promoters. Virale promoters zoals de 35S RNA en
19S RNA promoters van CaMV (Brisson et al., 1984, Nature 310: 511-514), of de
promoter van het manteleiwit van TMV (Takamatsu et al., 1987, EMBO 1 6: 307-311)
kunnen worden gebruikt; als alternatief kunnen plantenpromoters zoals de kleine su-
10 beenheid van RUBISCO (Coruzzi et al., 1984, EMBO J. 3: 1671-1680; Brogue et al.,
1984, Science 224: 838-843) of heat-shock promoters, bijvoorbeeld hspl7.5-E of
hspl7.3-B van soja (Gurley et al., 1986, Mol. CeU. Biol. 6: 559-565) worden gebruikt
Deze constructen kunnen worden geïntroduceerd in leukocyten van planten door het
gebruik van Ti-plasmiden, Ri-plasmiden, plantenvirus-vectoren, directe DNA trans-
15 formatie, micro-injectie, elektroporatie enzovoort. Zie voor samenvattingen van derge-
lijke technieken bijvoorbeeld Weissbach & Weissbach, 1988, Methods for Plant Mole-
cular Biology, Academic Press, NY, Deel VIH, blz. 421-463; en Grierson & Corey,
1988, Plant Molecular Biology, 2d Ed., Blackie, London, Hoofdstuk 7-9.
[0200] Bij één expressiesysteem voor insecten dat kan worden gebruikt voor het
20 produceren van de peptiden van de uitvinding wordt het nucleaire polyhidrosis virus
Autographa californica (AcNPV) gebruikt als een vector voor het tot expressie brengen
van vreemde genen. Het virus groeit in ceüen van Spodoptera frugiperda. Een code-
rende sequentie kan worden gekloneerd in niet-essentiële gebieden (bijvoorbeeld het
polyhedron gen) van het virus en worden geplaatst onder de regulering van een AcNPV
25 promoter (bijvoorbeeld de polyhedron promoter). SuccesvoUe insertie van een code-
rende sequentie zal resulteren in inactivatie van het polyhedron gen en productie van
niet afgesloten recombinant virus (d.w.z. virus dat de eiwitachtige mantel mist die
wordt gecodeerd door het polyhedron gen). Deze recombinante virussen worden ver-
volgens gebruikt voor het infecteren van ceüen van Spodoptera frugiperda waarin het
30 geïnsereerde gen tot expressie wordt gebracht, (bijvoorbeeld zie Smith et al., 1983, J.
Virol. 46: 584; Smith, Amerikaans ocfrooischriftnurnmer 4.215.051). Andere voorbeel-
den van dit expressiesysteem kunnen worden gevonden in Current Protocols in Mole-
EU 1537 415 Bl
2.MAR.2009 15=40 NED. OCTROOIBUREAU 43703527580 NO.059 P.7
ACCOUNTS
92
cular Biology, Vol. 2, Ausubel et al., redacteuren, Greene PubUsh. Assoc. & Wüey In-
terscience.
[0201] Bij zoogdierüjke gastheerceUen kunnen een aantal van viraal gebaseerde
expressiesystemen worden gebruikt. In gevaUen waarbij een adenovirus wordt gebruikt
5 als een expressievector kan een coderende sequentie worden geügeerd aan een trans-
criptie/translatie regulerend complex van adenovirus, bijvoorbeeld de late promoter en
tripartiet leader sequentie. Dit chimère gen kan vervolgens worden geïnsereerd in het
adenovirus genoom door in vitro of in vivo recombinatie. Insertie in een niet-essentieel
gebied van het virale genoom (bijvoorbeeld gebied El of E3) zal resulteren in een re-
10 combinant virus dat levensvatbaar is en in staat is peptide tot expressie te brengen in
geïnfecteerde gastheren. (Zie bijvoorbeeld Logan & Shenk, 1984, Proc. Natl. Acad.
Sei. USA 81: 3655-3659), Als alternatief kan de 7.5 K promoter van vaccinia worden
gebruikt (zie bijvoorbeeld Mackett et al., 1982, Proc. Natl. Acad. Sei. USA 79: 7415-
7419; Mackett et al., 1984, J. Virol. 49: 857-864; Panicaü et al, 1982, Proc. Natl.
15 Acad. Sei. USA 79: 4927-4931).
[0202] Andere expressiesystemen voor het produceren van lineaire peptiden van de
uitvinding zullen voor de deskundigen in het vakgebied duideUjk zijn.
20
C. Labels of merkers
[0203] Labels en merkers worden veelvuldig gebruikt om te helpen bij het zuive-
ren van bestanddelen of detectie van biologische moleculen. Voorbeelden van biologi-
sche labels omvatten, maar zijn niet beperkt tot, glutathion-S-transferase, maltose bin-
dend eiwit, immunoglobuline domeinen, intein, hemagglutinine epitopen, myc-epi-
25 topen, enzovoort, Voorbeelden van chemische labels omvatten, maar zijn niet beperkt
tot biotine, goud, paramagnetische deeltjes of fluoroforen. Deze voorbeelden kunnen
worden gebruikt voor het identificeren van de aanwezigheid van eiwitten of verbindin-
gen waar aan ze zijn verbonden of ze kunnen door de deskundigen in het vakgebied
worden gebruikt voor het zuiveren van eiwitten of verbindingen van complexe meng-
30 sels.
EU 1537 415 Bl
2.MAR.2009 15=40 NED. OCTROOIBUREAU 43703527580 NO.059 P.8
ACCOUNTS
93
D. Zuivering van de peptiden en peptide-analoga
[0204] De peptiden en peptide-analoga van de uitvinding kunnen worden gezui-
verd door in het vakgebied bekende technieken zoals vloeistofchromatografie met groot
5 scheidend vermogen, ionuitwisselingschromatografie, gelelektroforese, affiniteitschro-
matografie en dergeUjke. De werkeUjke omstandigheden die worden gebruikt voor het
zuiveren van een specifiek peptide of analoog zal afhangen, gedeelteüjk, van factoren
zoals netto lading, hydrofobiciteit, enzovoort., en zal bij de deskundigen in het vakge-
bied duideUjk zijn. De gezuiverde peptiden kunnen worden geïdentificeerd door testen
10 die zijn gebaseerd op de fysische en functionele eigenschappen ervan, waaronder ra-
dioactieve merken gevolgd door gelelektroforese, radio-immuuntesten, ELISA, biolo-
gische testen en dergeUjke.
15
XELKits
[0205] De onderhavige uitvinding omvat ook kits voor het uitvoeren van de
werkwijzen van de uitvinding. Een onderhavige kit bevat gewoonUjk een eerste en
tweede oncogene HPV E6-bindende partner. Bij de meeste uitvoeringsvormen is de
eerste bindende partner een PDZ-domein polypeptide en is de tweede bindende partner
20 tenminste één antüichaam voor E6. Bij sommige uitvoeringsvormen is de tweede bin-
dende partner gemerkt met een detecteerbare merker. Bij andere uitvoeringsvormen is
een tweede merkend bestanddeel, zoals een detecteerbaar gemerkt secundair antüi-
chaam opgenomen. Bij sommige uitvoeringsvormen omvat een onderhavige kit verder
een wijze, zoals een inrichting of een systeem, voor het isoleren van oncogeen HPV E6
25 van het monster. De kit kan eventueel proteasoom-remmer bevatten.
[0206] Een onderhavige kit kan verder, indien gewenst, één of meer verscheidene
gebruikeUjke bestanddelen omvatten zoals bijvoorbeeld houders met één of meer buf-
fers, detectiereagens of antüichamen. Gedrukte instructies ofwel als bijlagen of als eti-
ketten, die de hoeveelheden van de bestanddelen aangeven die moeten worden gebruikt
30 en de richtüjnen voor het gebruik ervan, kunnen ook in de kit worden opgenomen. In
de onderhavige beschrijving zou het duideUjk moeten zijn dat de gespecificeerde mate-
rialen en omstandigheden belangrijk zijn bij het uitvoeren van de uitvinding maar dat
niet-gespecificeerde materialen en omstandigheden niet worden uitgesloten zolang ze
EU 1537 415 Bl
2.MAR.2009 15=41 NED. OCTROOIBUREAU 43703527580 NO.059 P.9
ACCOUNTS
94
niet de voordelen van de uitvinding om te worden gereaüseerd voorkomen, fllustratieve
uitvoeringsvormen van de diagnostische werkwijzen van de uitvinding zijn hierboven
in detaü beschreven.
[0207] In een onderhavige kit kan de oncogene E6 detectiereactie worden uitge-
5 voerd door het gebruik van een waterig of vast substraat waarbij de kit reagens kan
bevatten voor gebruik met verscheidene materialen voor scheiding en detectie zoals
teststrips, sandwich testen, enzovoort. Bij veel uitvoeringsvormen van de kit met de
teststrip heeft de teststrip daar aan gebonden een PDZ-domein polypeptide dat op spe-
cifieke wijze bindt aan het PL-domein van een oncogeen E6-eiwit en oncogeen E6-ei-
10 wit vangt op de vaste drager, Bij sommige uitvoeringsvormen omvat de kit verder een
detecterend antilichaam of antüichamen dat of die ofwel direct of indirect detecteerbaar
is of zijn en dat of die bindt aan het oncogene E6-eiwit om de detectie ervan mogeüjk
te maken. Kits kunnen ook bestanddelen bevatten voor het uitvoeren van Western blots
(bijvoorbeeld vooraf bereide gels, membranen, systemen voor overdracht, enzovoort);
15 bestanddelen voor het uitvoeren van ELISA's (bijvoorbeeld platen met 96 putjes); be-
standdelen voor het uitvoeren van immunoprecipitatie (bijvoorbeeld proteïne-A); ko-
lommen, in het bijzonder centrifugekolommen, voor scheiden van oncogeen E6-eiwit
van een monster op affiniteit of grootte (bijvoorbeeld gelfütratiekolommen, PDZ-do-
mein polypeptide kolommen, kolommen voor uitsluiting op grootte, centrifugekolom-
20 men met een membraan met een uitsluiting op grootte, enzovoort).
[0208] Onderhavige kits kunnen ook controle monsters bevatten die oncogeen of
niet-oncogeen E6 en/of een verdunningsserie van oncogeen E6 bevatten, waarbij de
verdunningsserie een traject van juiste standaarden vertegenwoordigt waarmee een ge-
bruiker van de kit de resultaten ervan kan vergeüjken en het niveau van oncogeen E6 in
25 hun monster kan schatten. Een dergeUjke verdunningsserie kan een schatting van de
progessie van elke kanker bij een patiënt verschaffen. Resultaten van fluorescentie,
kleur of autoradiologische film ontwikkeling kunnen ook worden vergeleken met een
standaard kromme van fluorescentie, kleur of filmdichtheid die door de kit wordt ver-
schaft.
30 [0209] In aanvulling op de hierboven genoemde bestanddelen omvatten de
onderhavige kits kenmerkend verder instructies voor het gebruik van de bestanddelen
van de kit voor het uitvoeren van de onderhavige werkwijzen. De instructies voor het
uitvoeren van de onderhavige werkwijzen zijn algemeen geregistreerd op een geschikt
EU 1537 415 Bl
2.MAR.2009 15=41 NED. OCTROOIBUREAU 43703527580 NO.059 P.10
ACCOUNTS
95
opnamemedium. De instructies kunnen bijvoorbeeld worden gedrukt op een substraat
zoals papier of plastic, enzovoort Als zodanig kunnen de instructies in de kits aanwe-
zig zijn als een verpakkingsbijlage, op het etiket van de houder van de kit of bestaud-
delen daarvan (d.w.z. geassocieerd met de verpakking of subverpakking), enzovoort
5 Bij andere uitvoeringsvormen zijn de instructies aanwezig als een elektronisch opge-
slagen gegevensbank die aanwezig is op een geschikte computer-leesbaar opslagme-
dium bijvoorbeeld CD-ROM, diskette, enzovoort. In nog andere uitvoeringsvormen
zijn de feiteUjke instructies niet aanwezig in de kit maar worden wijzen voor het ver-
krijgen van de instructies van een afzonderlijke bron, bijvoorbeeld door middel van het
10 internet, verschaft. Een voorbeeld van deze uitvoeringsvorm is een kit die een web
adres omvat waar de instructies kunnen worden gezien en/of waarvan de instructies
kunnen worden gedownload. Zoals met instructies is deze wijze voor het verkrijgen van
de instructies geregistreerd op een geschikt substraat.
[0210] Ook worden door de onderhavige uitvinding kits verschaft die tenminste
15 een computer-leesbaar medium omvatten dat programmering omvat zoals hierboven is
beschreven en instructies. De instructies kunnen aanwijzingen voor instaUatie en in-
stelling omvatten. De instructies kunnen aanwijzingen voor het gebruik van de uitvin-
ding omvatten met opties of combinaties van opties zoals hierboven is beschreven. Bij
bepaalde uitvoeringsvormen omvatten de instructies beide soorten van informatie.
20 [0211] Het verschaffen van de software en instructies als een kit kan een aantal van
doelen dienen. De combinatie kan worden verpakt en worden verkocht als een wijze
voor het produceren van antüichamen van konijn die minder immunogeen zijn in een
niet-konijn gastheer dan een ouderüjk antüichaam of nucleotidesequenties ervan.
[0212] De instructies worden in het algemeen geregistreerd op een geschikt
25 opnamemedium, De instructies kunnen bijvoorbeeld worden gedrukt op een substraat,
zoals papier of plastic, enzovoort. Als zodanig kunnen de instructies aanwezig zijn in
de kits als een verpakkingsbijlage, op het etiket van de houder van de kit of bestandde-
len daarvan (d.w.z. geassocieerd met de verpakking of subverpakking), enzovoort. Bij
andere uitvoeringsvormen zijn de instructies aanwezig als een elektronisch gegevens-
30 bestand die aanwezig is op een geschikte computer-leesbaar opslagmedium, bijvoor-
beeld CD-ROM, diskette, enzovoort, waaronder hetzelfde medium waarop het pro-
gramma is gepresenteerd.
EU 1537 415 Bl
2.MAR.2009 15=42 NED. OCTROOIBUREAU 43703527580 NO.059 P.11
ACCOUNTS
96
WERKWIJZEN VOOR HET BEPALEN OF EEN PERSOON IS GEÏNFECTEERD
MET EEN ONCOGENE STAM VAN HPV
[0213] De onderhavige uitvinding verschaft werkwijzen voor het detecteren van
5 oncogeen HPV E6-eiwit in een monster en vindt toepassing bij het diagnosticeren van
HPV-infectie bij een persoon. Bij vele uitvoeringsvormen wordt een biologisch mon-
ster verkregen van een persoon en wordt de aanwezigheid van oncogeen HPV E6-eiwit
in het monster bepaald. De aanwezigheid van een detecteerbare hoeveelheid van onco-
geen HPV E6-eiwit in een monster geeft aan dat het individu is geïnfecteerd met een
10 oncogene stam van HPV. Bij andere uitvoeringsvormen wordt het niveau van oncogeen
HPV E6-eiwit in een biologisch monster bepaald en vergeleken met de hoeveelheid van
een controle in een monster. De relatieve hoeveelheid van oncogeen HPV E6-eiwit in
een monster geeft de ernst aan van de infectie door HPV.
[0214] De werkwijzen behelzen in het algemeen twee bindende partners van onco-
15 geen HPV E6-eiwit, waarvan één een PDZ-domein polypeptide is zoals hierboven is
beschreven. In het algemeen behelzen de werkwijzen a) het isoleren van het oncogene
HPV E6-eiwit van een monster door het gebruik van één van de bindende partners en
b) het detecteren van oncogeen HPV E6-eiwit met de andere bindende partner,
20 Isoleren van oncogeen HPV E6-eiwit
[0215] fa het algemeen behelzen werkwijzen van de uitvinding tenminste een ge-
deelteüjke scheiding (d.w.z. isolatie) van natief oncogeen HPV E6-eiwit van andere
eiwitten in een monster. Deze scheiding wordt gewoonUjk bereikt door het gebruik van
25 een eerste bindende partner voor het oncogene HPV E6. Bij veel uitvoeringsvormen is
de eerste bindende partner een PDZ-domein polypeptide of bij andere uitvoerings-vor-
men een anti-HPV E6 antüichaam of mengsel van antüichamen.
[0216] Bij bepaalde uitvoeringsvormen wordt één van de oncogene HPV E6-bin-
dende partners gebonden, direct of door middel van een linker, aan een onoplosbare
30 drager. Een PDZ-domein polypeptide kan bijvoorbeeld een PDZ-domein bevatten dat is
gefuseerd aan een fusiepartner, zoals hierin is beschreven, en die fusiepartner is op di-
recte wijze gebonden aan een vaste drager door middel van een chemische binding of
op indirecte wijze door middel van een verbinding of linker (bijvoorbeeld een flexibele
EU 1537 415 Bl
2.MAR.2009 15=42 NED. OCTROOIBUREAU 43703527580 NO.059 P.12
ACCOUNTS
97
ünker, een antiUchaam of andere bindende groep). Bij de meeste uitvoeringsvormen
wordt het PDZ-domein polypeptide op covalente wijze gebonden aan de vaste drager.
Vaste dragers zijn in het vakgebied bekend en omvatten, maar zijn niet beperkt tot, een
korrel (bijvoorbeeld magnetische korrels, polystyreen korrels en dergeUjke); een mem-
5 braan; en dergeUjke. In één niet-beperkend voorbeeld is het PDZ-domein polypeptide
gebonden aan een magnetische korrel, Het PDZ-domein polypeptide dat is gebonden
aan de magnetische korrel wordt in contact gebracht met het monster en nadat een
complex is gevormd tussen het antüichaam en elk E6-eiwit in het monster wordt een
magnetisch veld aangebracht zodanig dat het complex van het monster wordt verwij-
10 derd. Wanneer bet PDZ-domein polypeptide is gebonden aan een onoplosbare drager,
zoals een membraan, wordt het E6-eiwit gebonden aan het PDZ-domein polypeptide
verwijderd van het monster door het membraan te verwijderen of door het monster over
te dragen naar een afzonderlijke houder. Wanneer het PDZ-domein polypeptide is ge-
bonden aan een korrel wordt het E6-eiwit gebonden aan de korrel verwijderd van het
15 monster door centrifugatie of filtratie. DergeUjke uitvoeringsvormen worden be-
schouwd door het gebruik van een andere E6-bindende partner, bijvoorbeeld een anti-
E6 antiUchaam.
[0217] In het algemeen wordt een geschikt middel voor scheiding gebruikt met een
geschürte platform voor het uitvoeren van de scheiding. Wanneer bijvoorbeeld onco-
20 geen HPV E6 wordt gescheiden door binding aan PDZ-domein Polypeptiden wordt de
scheiding bijvoorbeeld uitgevoerd door het gebruik van elk van een verscheidenheid
van platforms waaronder, maar niet beperkt tot, affiniteitskolom-chromatografie, test-
strips met capillaire werking of laterale stroom, immuno-precipitatie, enzovoort.
[0218] Bij veel uitvoeringsvormen wordt oncogeen HPV E6 van andere eiwitten in
25 het monster gescheiden door het toedienen van het monster aan één uiteinde van een
teststrip en het mogeUjk maken dat de eiwitten door capiUaire werking of laterale stro-
ming migreren. Werkwijzen en inrichtingen voor scheiding door laterale stroming, de-
tectie en kwantificering zijn in het vakgebied bekend. Zie bijvoorbeeld Amerikaanse
octrooischriftnummers 5.569.608; 6.297.020; en 6.403.383. Bij deze uitvoerings-vor-
30 men omvat een teststrip in de volgorde van proximale uiteinde naar distale uiteinde een
gebied voor het opbrengen van het monster (het monster-opbreng gebied) en een test-
gebied dat een oncogeen E6-eiwit-bindende partner bevat, bijvoorbeeld een gebied dat
een PDZ-domein polypeptide bevat of in andere uitvoeringsvormen een gebied dat een
EU 1537 415 Bl
2.MAR.2009 15=43 NED. OCTROOIBUREAU 43703527580 NO.059 P.13
ACCOUNTS
98
anti-E6 antüichaam bevat Het monster wordt op het monster-opbreng gebied gebracht
en het proximale uiteinde van de teststrip wordt in een buffer geplaatst Oncogeen E6-
eiwit wordt gevangen door het gebonden antiUchaam in het eerste testgebied. Detectie
van het gevangen oncogene E6-eiwit wordt uitgevoerd zoals hieronder is beschreven.
5 Detectie van gevangen E6-eiwitten wordt bijvoorbeeld uitgevoerd door het gebruik van
op detecteerbare wijze gemerkt antüichaam dat specifiek is voor een epitoop van E6-
eiwitten dat algemeen is voor aUe oncogene E6-eiwitten of een mengsel van antüicha-
men dat tezamen aan aUe oncogene E6-eiwitten kan binden. In alternatieve uitvoe-
ringsvormen kan een E6-antÜichaam aanwezig zijn in het testgebied en wordt bij de
10 detectie van oncogeen E6 gebonden aan het E6-antüichaam gebruik gemaakt van een
gemerkt PDZ-domein polypeptide.
Het detecteren en kwantificeren van oncogeen E6-eiwit
15 [0219] Wanneer oncogeen E6-eiwit eenmaal is gescheiden van andere eiwitten in
het monster wordt oncogeen E6-eiwit gedetecteerd en/of het niveau of de hoeveelheid
van oncogeen E6-eiwit wordt bepaald (bijvoorbeeld gemeten). Zoals hierboven is be-
schreven wordt oncogeen E6-eiwit in het algemeen gedetecteerd door het gebruik van
een bindende partner, bijvoorbeeld een antüichaam of antiUchamen die specifiek zijn
20 voor E6 of een PDZ-domein polypeptide.
[0220] Detectie met een specifiek antüichaam wordt uitgevoerd door het gebruik
van goed bekende werkwijzen. De bindende partner is in het algemeen op detecteerbare
wijze gemerkt ofwel direct of indirect. Directe merkers omvatten radioactieve isotopen
(bijvoorbeeld ,25I; 35S en dergeUjke); enzymen waarvan de producten detecteerbaar zijn
25 (bijvoorbeeld luciférase, ß-galactosidase, mierikswortelperoxidase en dergeUjke); fluo-
rescente merkers (bijvoorbeeld fluoresce'me-isothiocyanaat, rhodamine, phycoeiythrine
en dergeUjke); fluoiescentie-emitterende metalen, bijvoorbeeld 152Eu, of andere van de
lanthanide series, verbonden aan het antiUchaam door middel van metaal-chelerende
groepen zoals EDTA; chemüuminescente verbindingen bijvoorbeeld Iuminol, isolumi-
30 nol, acridinium zouten en dergeUjke; bioluminescente verbindingen bijvoorbeeld luci-
ferine; fluorescente eiwitten en dergelijke. Fluorescente eiwitten omvatten, maar zijn
niet beperkt tot, een groen fluorescent eiwit (GFP), waaronder maar niet beperkt tot
een "gehumaniseerde" versie van een GFP, waarin bijvoorbeeld codons van de natuur-
EU 1 537 415 Bl
2.MAR.2009 15=43 NED. OCTROOIBUREAU 43703527580 NO.059 P.14
ACCOUNTS
99
Ujk voorkomende nucleotidesequentie zijn veranderd naar meer nauwkeurig overeen-
komende humane codon voorkeur; een GFP afkomstig van Aequoria victoria of een
derivaat daarvan, bijvoorbeeld een "gehumaniseerd" derivaat zoals versterkt GFP dat in
de handel verkrijgbaar is van bijvoorbeeld Clontech, Inc.; een GFP van een andere
5 soort zoals Renilla reniformis, Renilla mulleri, of Ptilosarcus guemyi, zoals bijvoor-
beeld is beschreven in WO 99/49019 en PeeUe et al. (2001) J Protein Chem. 20: 507-
519; "gehumaniseerd" recombinant GFP (hrGFP) (Stratagene); elk van een verschei-
denheid van fluorescente en gekleurde eiwitten van soorten van Anthozoa zoals is be-
schreven in bijvoorbeeld Matz et al. (1999) Nature Biotechnol. 17: 969-973; en derge-
10 lijke.
[0221] Indirecte merkers omvatten tweede antüichamen die specifiek zijn voor E6-
specifieke antüichamen waarbij het tweede antiUchaam is gemerkt zoals hierboven is
beschreven; en leden van specifieke bindende paren, bijvoorbeeld biotine-avidine en
dergeUjke. .
15 [0222] Bij sommige uitvoeringsvormen wordt een niveau van oncogeen E6 ge-
kwantificeerd. Kwantificering kan worden uitgevoerd door het gebruik van elke be-
kende werkwijze waaronder, maar niet beperkt tot, enzym-gekoppelde immuunabsor-
berende test (ELISA); radioactieve immuuntest (RIA); en dergeUjke. Kwantificering
wordt in het algemeen volbracht door het vergeüjken van het niveau van expressiepro-
20 duet dat wordt gedetecteerd in het monster met een standaard kromme.
[0223] Bij sommige uitvoeringsvormen wordt oncogeen HPV E6 gescheiden op
een teststrip zoals hierboven is beschreven. Bij deze uitvoeringsvormen wordt onco-
geen HPV E6 gedetecteerd door het gebruik van een op detecteerbare wijze gemerkte
bindende partner die oncogeen HPV E6 bindt. Oncogeen HPV E6 kan worden ge-
25 kwantificeerd door bijvoorbeeld het gebruik van een reflectie spectrofotometer of met
het oog.
BIOLOGISCHE MONSTERS
30 [0224] Biologische monsters die geanalyseerd moeten worden door het gebruik
van de werkwijzen van de uitvinding worden verkregen van elk zoogdier, bijvoorbeeld
een mens of een niet-humaan dierüjk model van HPV. Bij veel uitvoeringsvormen
wordt het biologische monster verkregen van een levend persoon.
EU 1537 415 Bl
2.MAR.2009 15=44 NED. OCTROOIBUREAU 43703527580 NO.059 P.15
ACCOUNTS
IOO
[0225] Bij sommige uitvoeringsvormen is de persoon waarvan het monster wordt
verkregen ogenschijnüjk gezond, waarbij de analyse wordt uitgevoerd als een deel van
een routine screening, Bij andere uitvoeringsvormen is de persoon iemand die gevoeüg
is voor HPV (bijvoorbeeld zoals is bepaald door de geschiedenis van de famiüe; bloot-
5 stelling aan bepaalde omgevingsfactoren; enzovoort). Bij andere uitvoerings-vormen
heeft de persoon symptomen van HPV (bijvoorbeeld cervicale wratten of dergeUjke).
Bij andere uitvoeringsvormen is de persoon voorlopig gediagnosticeerd als HPV te
hebben (bijvoorbeeld zoals is bepaald door andere testen die zijn gebaseerd op bijvoor-
beeld PCR).
10 [0226] Het biologische monster kan afkomstig zijn van elk weefsel, orgaan of
groep van ceUen van de persoon. Bij sommige uitvoeringsvormen wordt een cervicale
afschraping, biopsie of lavage verkregen van een persoon.
[0227] Bij sommige uitvoeringsvormen wordt het biologische monster bewerkt
bijvoorbeeld voor het verwijderen van bepaalde bestanddelen die zouden kunnen inter-
15 fereren met een testwerkwijze van de uitvinding, door het gebruik van werkwijzen die
standaard zijn in het vakgebied. Bij sommige uitvoeringsvormen wordt het biologische
monster bewerkt om te veirijken op eiwitten, bijvoorbeeld door precipitatie met zout en
dergeUjke. Bij bepaalde uitvoeringsvormen wordt het monster bewerkt in de aanwezig-
heid van proteasoom remmer voor het remmen van de afbraak van het E6-eiwit
20 [0228] Bij de testwerkwijzen van de uitvinding kan bij sommige uitvoerings-vor-
men het niveau van E6-eiwit in een monster worden gekwantificeerd en/of worden ver-
geleken met controles. Geschikte controle monsters zijn van individuen waarvan be-
kend is dat ze gezond zijn, bijvoorbeeld individuen waarvan bekend is dat ze niet HPV
hebben. Controle monsters kunnen van individuen zijn die genetisch verwant zijn aan
25 de persoon die wordt getest maar kunnen ook van genetisch niet verwante individuen
zijn. Een geschikt controle monster omvat ook een monster van een individu dat op een
eerder tijdstip is genomen dan het tijdstip waarop het testmonster is genomen, bijvoor-
beeld een biologisch monster dat van het individu is genomen voorafgaand aan het
vertonen van mogeUjke symptomen van HPV.
30
EU 1537 415 Bl
2.MAR.2009 15=44 NED. OCTROOIBUREAU 43703527580 NO.059 P.16
ACCOUNTS
101
TOEPASSING
[0229] De werkwijzen van de onderhavige uitvinding zijn bruikbaar voor een ver-
scheidenheid van diagnostische analysen. De onderhavige werkwijzen zijn bruikbaar
5 voor bet diagnosticeren van infectie door een oncogene stam van HPV bij een individu;
voor het bepalen van de aannemeüjkheid van het hebben van kanker; voor het bepalen
van een reactie van een patiënt op behandeUng voor HPV; voor het bepalen van de
ernst van de HPV-infectie bij een individu; en voor het volgen van de progressie van
HPV bij een individu.
10 [0230] De onderhavige werkwijzen kunnen in het algemeen worden uitgevoerd op
biologische monsters van levende personen, Een in het bijzonder voordelig kenmerk
van de uitvinding is dat de werkwijzen geUjktijdig in één reactie aüe bekende oncogene
stammen van HPV kunnen detecteren.
15 VOORBEELD 1
SEQUENTIE-ANALYSE VAN HPV E6-EIWITTEN VOOR HET BEPALEN VAN
ONCOGEEN POTENTIEEL
[0231] Het is van PDZ-eiwitten bekend dat ze bepaalde carboxyl-eindstandige se-
20 quenties van eiwitten binden (PL's). PL-sequenties die PDZ-domeinen binden zijn
voorspelbaar en zijn in meer detail beschreven in Amerikaanse octrooi-aanvragen
09/710059, 09/724553 en 09/688017. Eén van de voorname klassen van PL-motieven
is de set van eiwitten die eindigen in de sequenties -X-(S/T)-X-(V/1/L). We hebben de
C-eindstandige sequenties van E6-eiwitten van een aantal van HPV-stammen onder-
25 zocht. Alle stammen die door het National Cancer Institute werden bepaald oncogeen te
zijn vertonen een consensus PDZ-bindende sequentie. Die E6-eiwitten van stammen
van papülomavirus die niet kankerverwekkend zijn missen een sequentie waarvan zou
worden voorspeld dat ze binden aan PDZ-domeinen, dat aldus suggereert dat interactie
met PDZ-eiwitten een voorwaarde is voor het veroorzaken van kanker bij mensen.
30 Deze correlatie tussen de aanwezigheid van een PL en het vermogen om kanker te ver-
oorzaken is 100% bij de sequenties die zijn onderzocht (Tabel 3A). In theorie kunnen
met de beschreven PL consensussequenties van de octrooien die hierboven zijn opge-
somd nieuwe varianten van HPV's worden beoordeeld op het vermogen ervan om te
EU1537 415B1
2.MAR.2009 15:45
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.059
P. 17
102
binden aan PDZ-eiwitten en oncogeniciteit kan worden voorspeld op basis of een PL
aanwezig is. Eerder dit jaar werden vijf nieuwe oncogene stammen van humaan papÜ-
lomavirus geïdentificeerd en van de E6-eiwitten ervan de sequentie geanalyseerd. Zoals
is voorspeld bevatten deze eiwitten aüe een PL consensus sequentie (Tabel 3B).
Tabel 3 A: Correlatie van E6 PDZ-Uganden en < ancogeniciteit
HPV stam E6 C-ejndstandige sequentie PLja/nee Oncogeen SEQ ID NO
HPV 4 GYCRNCIRKQ Nee Nee 221
HPVU WTTCMEDLLP Nee Nee 222
HPV 20 GICRLCKHFQ Nee Nee 223
HPV 24 KGLCRQCKQI Nee Nee 224
HPV 28 WLRCTVRTPQ Nee Nee 225
HPV 36 RQCKHFYNDW Nee Nee 226
HPV 48 CRNCISHEGR Nee Nee 227
HPV 50 CCRNCYEHEG Nee Nee 228
HPV 16 SSRTRRETQL Ja Ja 229
HPV 18 RLQRRRETQV Ja Ja 230
HPV 31 WRRPRTETQV Ja Ja 231
HPV 35 WKPTRRETEV Ja Ja 232
HPV 30 RRTLRRETQV Ja Ja 233
HPV 39 RRLTRRETQV Ja Ja 234
HPV 45 RLRRRRETQV Ja Ja 235
HPV 51 RLQRRNETQV Ja Ja 236
HPV 52 RLQRRRVTQV Ja Ja 237
HPV 58 TSREPRESTV Ja Ja 238
HPV 59 QRQARSETLV Ja Ja 239
HPV 58 RLQRRRQTQV Ja Ja 240
HPV 33 RLQRRRETAL Ja Ja 241
HPV 66 TSRQATESTV Ja .Ta"1 242
HPV 68 RRRTRQETQV Ja Ja 243
HPV 69 RRREATETQV Ja Ja 244
Tabol 3A: B6 C-eindstandige sequenties en oncogeniciteit. HPV varianten zijn aan de inkerkant opge-
somd. Sequenties werden geïdentificeerd van de sequentieregistralies vap Genbank. PL ja/nee werd
bepaald door een overeenkomst of geen overeenkomst met de consensus die werd bepaald bij Arbor
Vita en door Songyang et al. ~X-(S/T>X-(V/IZL). Gegevens van oncogeniciteit die zijn verzameld van
het National Cancer Institute. *Alleen gevonden in oncogene stammen die tezamen zijn getransfecteerd
met andere oncogene eiwitten.
EU 1537 415 Bl
2.MAR.2009 15:45
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.059
P. 18
103
Tabel 3B: Correlatie van recent geïdentificeerde oncogene E6-eiwitten
10
HPV-stam E6 C-eindstandige sequentie PL ja/nee Oncogeen SEQIDNO
HPV 26 HPV 53 HPV 66 HPV 73 HPV 82 RPRRQTETQV RHTTATESAV TSRQATESTV RCWRPSATW PPRQRSETQV Ja Ja Ja Ja Ja Ja Ja Ja Ja Ja 245 246 247 248 249
Tabel 3B: E6 C-eindstandige sequenties en oncogeniciteit HPV varianten zijn aan de linkerkant opgesomd. Sequenties werden geïdentificeerd van de sequentieregistraties van Genbank. PL ja/nee werd bepaald door een overeenkomst of geen overeenkomst met de consensus die werd bepaald bij Arbor Vita en door Songyang et al. -X-(S/T)-X-(V/]/L). Oncogeniciteit gegevens van nieuwe stammen verzameld van N. Engl J. Med 2003; 348: 518-527.
[0232] Deze tabellen verschaffen een classificatie van de HPV-stammen op basis
van de sequentie van de C-eindstandige vier aminozuren van het E6-eiwit dat wordt
gecodeerd door het HP V-genoom. De 21 oncogene stammen van HPV vaüen in één
van 10 klassen en HPV-stammen die niet specifiek hierboven zijn opgesomd kunnen
ook in deze klassen vaUen. Als zodanig is het gewenst om HPV-stammen van aUe 10
klassen te detecteren; de onderhavige werkwijzen verschaffen een dergeUjke detectie.
VOORBEELD 2
IDENTIFICATIE VAN PDZ-DOMEINEN DIE INTERACTIE VERTONEN MET DE
C-UITEINDEN VAN ONCOGENE E6-EIWHTEN
15
20
[0233] Teneinde de PDZ-domeinen te bepalen die kunnen worden gebruikt voor
het detecteren van oncogene E6-eiwitten in een diagnostische test werd de "G-test"
(hierboven beschreven) gebruikt voor het identificeren van interacties tussen PL's van
E6 en PDZ-domeinen. Peptiden werden gesynthetiseerd die overeenkomen met de C-
eindstandige aminozuursequenties van E6-eiwitten van oncogene stammen van humaan
papillomavirus, Deze peptiden werden beoordeeld op het vermogen om PDZ-domeinen
te binden door het gebruik van de G-test die hierboven is beschreven en de PDZ-eiwit-
ten die werden gesynthetiseerd van de expressieconstructen zijn in meer detaü beschre-
ven in Amerikaanse octrooi-aanvragen 09/710059, 09/724553 en 09/688017. Resulta-
EU 1537 415 Bl
2.MAR.2009 15:46
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.059
P. 19
10
104
ten van deze testen die een hoge bindingsaffiniteit tonen'zijn opgesomd in Tabel 4
hieronder.
[0234] Zoals hieronder kan worden gezien zijn er een groot aantal van PDZ-
domeinen die enige van de oncogene E6-eiwitten binden. Alleen het tweede PDZ-do-
mein van MAGI-1 Ujkt echter aüe van de oncogene E6 PL's die zijn getest te binden.
Het PDZ-domein van TIP-1 bindt alle behalve één van de oncogene E6 PL's die zijn
getest en kan bruikbaar zijn in samenhang met MAGI-1 domein 2 voor het detecteren
van de aanwezigheid van oncogene E6-eiwitten.
[0235] Op een overeenkomstige wijze werden peptiden die overeenkomen met de
C-eindstandige uiteinden van verscheidene niet-oncogene E6-eiwitten getest met de G-
test Geen van de peptiden toonde een affiniteit voor binding van PDZ-domeinen.
Tabel 4: Interacties met hogere affiniteit tussen E6 PL's van HPV en PDZ-domeinen
HPV-stam PDZ-bindende partner HPV-stam PDZ-bindende partner
(signaal 4 en 5 van 0-5) (signaal 4 en 5 van 0-5)
HPV 35 Atrofinc-1 interact eiwit HPV 33 Magi 1 (PDZ #2)
(TEV) (PDZ#1,3,5) (TAL) TJP1
Magü(PDZ#2,3,4,5) DLG1 Vartul (PDZ #])
Lim-Ril KIAA 0807
HJ 11215 KIAA 1095
MUPP-1 (PDZ #10) (Semcap3) (PDZ#1)
KIAA 1095 (PDZ #1) KIAA 1934 (PDZ #1)
PTN-4 NeDLG(PDZ#l,2)
INADL(PDZ#8) Buitenste membraan rat (PDZ #1)
Vartul (PDZ #1,2,3) PSD 95 (PDZ #3 en 1-3)
Syntrofine-1 alfa
Syntroßne gamma-1 TAX IP2
KIAA 0807
KIAA 1634 (PDZ #1)
DLG1 (PDZ 1,2)
NeDLO(l,2,3)
Sim buitenste membraan rat (PDZ
#1)
MUPP-1 (PDZ #13)
? PSD 95 (1,2,3)
EU 1537 415 Bl
2.NAR.2009 15=46
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.059
P.20
105
HPV-stam PDZ-bindende partner (signaal 4 en 5 van 0-5) HPV-stam PDZ-bindende partner (signaal 4 en 5 van 0-5)
HPV 58 (TQV) Atrofine-1 interact eiwit (PDZ #1) Magil(PDZ#2) DLG1 (PDZ 1,2) DLG2(PDZ#2) KIAA 0807 KIAA 1634 (PDZ #1) NeDLG (1,2) Sim buitenste membraan rat 0?DZ #1) PSD 95 (1,2,3) INADL(PDZ#8) TTP-1 HPV 66 (STV) DLG1(PDZ#1,2) NeDLG (PDZ #2) PSD95(PDZ#1,2,3) Magil (PDZ #2) KIAA 0807 KIAA 1634 (PDZ #1) DLG2(PDZ#2) Buitenste membraan rat (PDZ #1) NeDLG (1,2) TIP-1
HPV 16* (TQL) TIP-1 Magil (PDZ #2) HPV 52 (TQV) Magil (PDZ#2)
HPV 18* (TQV) TIP1 Magi 1 (PDZ #2)
Tabel 4: Interacties tussen de E6 C-uiteinden van verscheidene HPV-varianten en bumane PDZ-domeinen. HPV-stam geeft dc stam aan waarvan de informatie van de C-eindstandige peptidosequentie van E6 werd verkregen. Peptiden die in de test werden gebruikt varieerden in lengte van 18 tot 20 aminozuren en de eindstandige vier residuen zijn tussen haakjes opgesomd. Namen aan de rechterkant van elke HPV E6-variant geven de humane PDZ-domein(en) aan (met het domeinnummer tussen haakjes voor eiwitten met meerdere PDZ-domeinen) die binding met het E6-peptide in de G-test verzadigde (zie beschrijving van de uitvinding), "'-geeft aan dat de PDZ-domeinen van hDlgl niet werden getest tegen deze eiwitten vanwege beperkt materiaal alhoewel het van beide in de literatuur is getoond dat ze hDlgl binden
VOORBEELD 3
GENERERING VAN EUKARYOTE EXPRESSIECONSTRUCTEN DIE DNA-
FRAGMENTEN DRAGEN DIE CODEREN VOOR E6-GENEN VAN HPV OF
DELEN VAN E6-GENEN VAN HPV
10
[0236] Dit voorbeeld beschrijft de klonering van E6-genen van HPV of delen van
E6-genen van HPV in eukaryote expressievectoren in fusie met een aantal eiwitmer-
kers, waaronder maar niet beperkt tot glutathion S-Transferase (GST), versterkt groen
fluorescent eiwit (EGFP), of hemagglutinine (HA).
EU 1 537 415 Bl
2.NAR.2009 15=46 NED. OCTROOIBUREAU 43703527580 NO.059 P.21
ACCOUNTS
106
A. Strategie
[0237] cDNA-firagmenten werden gegenereerd door RT-PCR van HPV-ceUijn
(cervicale épidermoïde carcinoorn, ATCC# CRL-I550 en CRL-1595 voor respectieve-
5 Ujk HPV E6 16 en 18) afkomstig RNA, door het gebruik van wülekeurige (oUgo-nu-
cleotide) primers (Invitrogen Cat# 48190011). DNA-fragmenten die overeenkomen
met HPV E6 werden gegenereerd door standaard PCR door het gebruüc van de hierbo-
ven gezuiverde cDNA-fragmenten en specifieke primers (zie Tabel 5). Primers die
werden gebruikt werden ontworpen voor het vormen van restrictienuclease herken-
10 ningsplaatsen aan de uiteinden van de PCR-fragmenten om klonering van die frag-
menten in geschikte expressievectoren mogeUjk te maken. Volgend op PCR werden
DNA-monsters onderworpen aan agarosegelelektroforese. Banden die overeen-komen
met de verwachte grote werden uitgesneden. DNA werd geëxtraheerd door Sephaglas
Band Prep Kit (Amersham Pharmacia Cat# 27-9285-01) en gedigereerd met het juiste
15 restrictie-endonuclease. Gedigereerde DNA-monsters werden nog één keer gezuiverd
door gelelektroforese, volgens hetzelfde protocol dat hierboven is gebruikt. Gezuiverde
DNA-fragmenten werden tezamen geprecipiteerd en geUgeerd met de juiste gelineari-
seerde vector. Na transformatie in E coli werden bacteriële kolonies gescreend door
kolonie PCR en restrictie digestie op de aanwezigheid en juiste oriëntatie van het insert.
20 Positieve klonen werden geënt in vloeibare kweek voor DNA-zuivering op grote
schaal. Van het insert en flankerende vectorplaatsen van het gezuiverde plasmide DNA
werd de sequentie geanalyseerd voor het verzekeren van de juiste sequentie van frag-
menten en overgangen tussen de vectoren en fusie-eiwitten.
25 B. Vectoren:
[0238] Kloneringsvectoren waren pGEX-3X (Amersham Pharmacia #27-4803-01),
MIE (een derivaat van MSCV, dat 1RES en EGFP bevat, gegenereerd door recombi-
nante DNA technologie), pmKit, pcDNA3.1 (Invitrogen, gemodificeerd om een HA-
30 merker stroomopwaarts van de kloneringsplaats te bevatten) en pMAL (New England
Biolabs Cat# N8076S, polylinker gemodificeerd in het eigen laboratorium om BamHI
en EcoRI plaatsen te omvatten).
EU 1537 415 Bl
2.MAR.2009 15=47
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.059
P. 22
107
[0239] DNA-fragmenten die het ATG startcodon en het TAG-stopcodon van HPV
E6 bevatten werden gekloneerd in pGEX3x. HPV E6 genen en 3'-niet afgeknotte
(APL) versies werden daaropvolgend gekloneerd in vector MIE (MSCV-IRES-EGFP),
vector pcDNA-HA en vector pmKit door het gebruik van het gezuiverde fusieplasmide
5 HPV E6-pGEX3x als de PCR matrijs en het gebruik van dezelfde protocoUen voor zui-
vering als hierboven zijn opgesomd. Afgeknotte versies van HPV E6 hebben een stop-
codon geïhsereerd na de -3 positie aminozuur zodat de laatste drie aminozuren van het
coderende gebied van het gen worden verwijderd.
10 C. Constructen:
[0240] Primers die zijn gebruikt voor het genereren van DNA-fragmenten door
PCR zijn in Tabel 5 opgesomd. PCR-primer combinaties en restrictieplaatsen voor in-
sert en vector zijn hieronder opgesomd.
15
Tabel 5. Primers die zijn gebruikt bij de klonering van HPV E6 in representatieve ex-
pressievectoren
ID# (naam primer) Sequentie primer Beschrijving SEQ ID
2548 (1054EF) AAAAGATCTACAAT ACTATGGCGC Heenwaartse (5' naar 3') primer die overeenkomt met HPV E6 18, genereert een Bgl II plaats. Wordt gebruikt voor klonering in pGEX3x 250
2549 (1058ER) AGGGAATTCCAGAC TTAATATTATAC Teruggaande (3' naar 5') primer die overeenkomt met HPV E6 18, genereert een EcoRI plaats. Wordt gebruikt voor klonering in pGEX3x. 251
2542 (1050EF) AAAGGATCCATTTT ATGCACCAAAAG Heenwaartse (5' naar 3') primer die overeenkomt met HPV E6 16, genereert een BamHI plaats. Wordt gebruikt voor klonering in pGEX3x 252
2543 (1051ER) ATGGAATTCTATCTC CATGCATGATTAC Teruggaande (3' naar 5') primer die overeenkomt met HPV E6 16, genereert cen EcoRI plaats. Wordt gebruikt voor klonering in pGEX3x. 253
2563 (1071EF) GAGGAATTCACCAC AATACTATGGCG Heenwaartse (5' naar 3') primer die overeenkomt met HPV E6 18, genereert een EcoRI plaats. Wordt gebruikt voor klonering in MIE 254
EU 1537 415 Bl
2.MAR.2009 15:47
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.059
P. 23
108
ID# (naam primer) Sequentie primer Beschrijving SEQ ID
2564 (1072ER) AGGAGATCTCATAC TTAATATTATAC Teruggaande (3' naar 5') primer die overeenkomt met HPV E6 18, genereert een BglH plaats. Wordt gebruikt voor klonering in MIE. 255
2565 (1073ERP L) TTGAGATCTTCAGC GTCGTTGGAGTCG Teruggaande (3' naar 5') primer die overeenkomt met HPV E6 18 APL, genereert een BglII plaats. Wordt gebruikt voor klonering in MIE. 256
2560 (1074EF) AAAGAATTCATriT ATGCACCAAAAG Heenwaartse (5' naar 3') primer die overeenkomt met HPV E6 16, genereert een EcoRI plaats. Wordt gebruikt voor klonering in MIE 257
2561 (1075ER) ATGGGATCCTATCTC CATGCATGATTAC Teruggaande (3' naar 5') primer die overeenkomt met HPV E6 16, genereert een BamHI plaats. Wordt gebruikt voor klonering in MIE. 258
2562 (1076ERP L) CTGGGATCCTCATC AACGTGTTCTTGATG Teruggaande (3' naar 5') primer die overeenkomt met HPV E6 16 APL, genereert een BamHI plaats. Wordt gebruikt voor klonering in MEE. 259
2603 (1080EF) AAGAAAGCTTTTTA TGCACCAAAAGAG Heenwaartse (5' naar 3') primer die overeenkomt met HPV E6 16, genereert een Hindin plaats. Wordt gebruikt voor klonering in pcDNA-HA 260
2604 (1081ER) AATCAAGCTTTATCT CCATGCATGATTAC Teruggaande (3' naar 5') primer die overeenkomt met HPV E6 16, genereert een HindIII plaats. Wordt gebruikt voor klonering in pcDNA-HA. 261
2605 (1082ERPL) . GCTGAAGCTTTCAA CGTGTTCTTGATGAT Teruggaande (3' naar 5') primer die overeenkomt met HPV E6 16 APL, genereert een HindIII plaats. Wordt gebruikt voor klonering in pcDNA-HA. 262
2606 (1083EF) AAGCGTCGACTTTA TGCACCAAAAGAG Heenwaartse (5' naar 3') primer die overeenkomt met HPV E6 16, genereert een Sali plaats. Wordt gebruikt voor klonering in pmKit. 263
2607 (1084ER) AATGCTCGAGTATC TCCATGCATGATTAC Teruggaande (3' naar 5') primer die overeenkomt met HPV E6 16, genereert een Xhol plaats. Wordt gebruikt voor klonering in pmKit. 264
2608 (1085ERPL) GCTGCTCGAGTCAA CGTGTTCTTGATGAT Teruggaande (3' naar 5') primer die overeenkomt met HPV E6 16 APL, genereert een Xhol plaats. Wordt gebruikt voor klonering in pmKit 265
2612 f (1086EF) AGAAGTCGACCACA ATACTATGGCGC Heenwaartse (5' naar 3') primer die overeenkomt met HPV E6 18, genereert een Sali plaats. Wordt gebruikt voor klonering in pmKit 266
EU 1537 415 Bl
2.MAR.2009 15:48
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.059
P. 24
109
ID# (naam primer) Sequentie primer Beschrijving SEQ ID
2613 (1087ER) TAGGCTCGAGCATA CTTAATATTATAC Teruggaande (3' naar 5') primer die overeenkomt met HPV E6 18, genereert een Xhol plaats. Wordt gebruikt voor klonering in pmKit 267
2614 (1088ERPL) CTTGCTCGAGTCAG CGTCGTTGGAGTCG Teruggaande (3' naar 5') primer die overeenkomt met HPV E6 18 APL, genereert een Xhol plaats, Wordt gebruikt voor klonering in pmKit 268
2615 (1089EF) AGAAAAGCTTCACA ATACTATGGCGC Heenwaartse (5' naar 3') primer die overeenkomt met HPV E6 18, genereert een HindIII plaats. Wordt gebruikt voor klonering in pcDNA-HA 269
2616 (1090ER) TAGAAGCTTGCATA CTTAATATTATAC Teruggaande (3' naar 5') primer die overeenkomt met HPV E6 18, genereert een HindIII plaats. Wordt gebruikt voor klonering in pcDNA-HA. 270
2617 (1019ERP L) CTTGAAGCTTTCAGC GTCGTTGAGGTCG Teruggaande (3' naar 5') primer die overeenkomt met HPV E6 18 APL, genereert een Hindm plaats. Wordt gebruikt voor klonering in pcDNA-HA. 271
10
15
1. Humaan Papülomavirus (HPV) E6 16
Acc#:
GI#: 4927719
? Construct: HPVE6 16WT-pGEX-3X
Primers: 2542 & 2543
Kloneringsplaatsen van de vector (573'): Bam Hl/EcoRl
Kloneringsplaatsen van het insert (573'): BamHl/EcoRl
pGEX-3X bevat GST tot het 5'-uiteinde (stroomopwaarts) van de kloneringsplaats
? Construct: HPV E6 16WT-MD3
Primers: 2560 & 2561
Kloneringsplaatsen van de vector (573'): EcoRl/BamHl
Kloneringsplaatsen van het insert (573'): EcoRl/BamHl
MIE bevat 1RES en EGFP aan het 3'-uiteinde (stroomafwaarts) van de kloneringsplaats
EU 1537 415 Bl
2.MAR.2009 15:48 NED. OCTROOIBUREAU 43703527580 NO.059 P.25
ACCOUNTS
no
? Construct: HPV E6 16APL-MIE
Primers: 2560 & 2562
Kloneringsplaatsen van de vector (573'): EcoRl/BamHl
Kloneringsplaatsen van het insert (573'); EcoRl/BamHl
5 MIE bevat 1RES en EGFP aan het 3'-uiteinde (stroomafwaarts) van de kloneringsplaats
? Construct: HPV E6 16WT-pcDNA3.1-HA
Primers: 2603 & 2604
Kloneringsplaatsen van de vector (573'): Hind IH/Hind Hl
10 Kloneringsplaatsen van het insert (5 73 ' ) : Hind IQ/Hind m
pcDNA3.1 (gemodificeerd) bevat HA aan het 5'-uiteinde (stroomopwaarts) van de klo-
neringsplaats
? Construct: HPVE6 16APL-pcDNA3,l-HA
15 Primers: 2603 & 2605
Kloneringsplaatsen van de vector (573(): Hind ID/Hind HI
Kloneringsplaatsen van het insert (573'): Hind TU/Hind JH
pcDNA3.1 (gemodificeerd) bevat HA aan het 5'-uiteinde (stroomopwaarts) van de klo-
neringsplaats
20
25
30
? Construct: HPV E6 16WT-pmKit
Primers: 2606 & 2607
Kloneringsplaatsen van de vector (573'): Sal I/Xho I
Kloneringsplaatsen van het insert (573'): Sal I/Xho I
? Construct: HPV E6 16APL-pmKit
Primers: 2606 & 2608
Kloneringsplaatsen van de vector (573'): Sal I/Xho I
Kloneringsplaatsen van het insert (573'): Sal 1/Xho I
2. Humaan papiUomavirus (HPV) E6 1 ft
Acc# :------------
GI# :-------------
EU 1537 415 Bl
2.MAR.2009 15:49 NED. OCTROOIBUREAU 43703527580 NO.059 P.26
ACCOUNTS
111
? Construct: HPV E6 18WT-pGEX-3X
Primers: 2548 & 2549
Kloneringsplaatsen van de vector (573'): Bam Hl/EcoRl
5 Kloneringsplaatsen van het insert (573'): Bgl D/EcoRl
pGEX-3X bevat GST aan het 5'-uiteinde (stroomopwaarts) van de kloneringsplaats
? Construct: HPV E6 18WT-MIE
Primers: 2563 & 2564
10 Kloneringsplaatsen van de vector (573'): EcoRl/BamHl
Kloneringsplaatsen van het insert (573'): EcoRl/Bgl II
MIE bevat 1RES en EGFP aan het 3'-uiteinde (stroomafwaarts) van de kloneringsplaats
? Construct: HPVE6 18AP]>M1E
15 Primers: 2563 & 2565
Kloneringsplaatsen van de vector (573'): EcoRl/BamHl
Kloneringsplaatsen van het insert (573'): EcoRl/Bgl II
MIE bevat 1RES en EGFP aan het 3'-uiteinde (stroomafwaarts) van de kloneringsplaats
20 ? Construct: HPV E6 18WT-pcDNA3.1-HA
Primers: 2615 & 2616
Kloneringsplaatsen van de vector (573'): Hind DI/Hind DI
Kloneringsplaatsen van het insert (573'): Hind m/Hind UI
pcDNA3.1 (gemodificeerd) bevat HA aan het 5'-uiteinde (stroomopwaarts) van de klo-
25 neringsplaats
? Construct: HPV E6 18APL-pcDNA3.1-HA
Primers; 2615 & 2617
Kloneringsplaatsen van de vector (573'): Hind IE/Hind Dl
30 Kloneringsplaatsen van het insert (573'): Hind ffl/Hind DI
pcDNA3.1 (gemodificeerd) bevat HA aan het 5'-uiteinde (stroomopwaarts) van de klo-
neringsplaats
EU 1537 415 Bl
2.MAR.2009 15=49 NED. OCTROOIBUREAU 43703527580 NO.059 P.27
ACCOUNTS
112
? Construct: HPV E6 18WT-pmKit
Primers; 2612 & 2613
Kloneringsplaatsen van de vector (573'): Sal I/Xho I
Kloneringsplaatsen van het insert (573'): Sal I/Xho I
5
? Construct: HPVE6 18APL-pmKit
Primers: 2612 & 2614
Kloneringsplaatsen van de vector (573'): Sal I/Xho I
Kloneringsplaatsen van het insert (573'); Sal I/Xho I
10
D. Productie en zuivering van GST fusie-eiwit
[0241] De constructen die gebruik maken van de pGEX-3X expressievector wer-
den gebruikt voor het maken van fusie-eiwitten volgens het protocol dat uiteengezet is
15 in het GST Fusion System, Tweede editie, Revision 2, Pharmacia Biotech. Method II
en werd geoptimaliseerd voor een IL LgPP,
[0242] Gezuiverd DNA werd getransformeerd in E. coli en toegestaan te gloeien
tot een OD60o van 0,4-0,8 (6Q0X). Eiwitexpressie werd gedurende 1-2 uur geïnduceerd
door toevoeging van D?TG aan de celkweek. CeUen werden geoogst en gelyseerd. Ly-
20 saat werd verzameld en GS4B korrels (Pharmacia Cat# 17-0756-01) werden toege-
voegd voor het binden van GST fusie-eiwitten. Korrels werden geïsoleerd en GST fu-
sie-eiwitten werden geëlueerd met GEB H. Gezuiverde eiwitten werden opgeslagen in
GEBDbij-80eC.
[0243] Gezuiverde eiwitten werden gebruikt voor ELISA-gebaseerde testen en
25 productie van antilichaam.
VOORBEELD 4
GENERERING VAN EUKARYOTE EXPRESSIECONSTRUCTEN DIE DNA-
FRAGMENTEN DRAGEN DIE CODEREN VOOR PDZ-DOMEIN BEVATTENDE
30 GENEN OF DELEN VAN PDZ-DOMEIN GENEN
[0244] Dit voorbeeld beschrijft de klonering van PDZ-domein-bevattende genen of
delen van PDZ-domein-bevattende genen in eukaryote expressievectoren in fusie met
EU 1537 415 Bl
2.MAR.2009 15:49 NED. OCTROOIBUREAU 43703527580 NO.059 P.28
ACCOUNTS
113
een aantal eiwitmerkers, waaronder maar niet beperkt tot glutathion S-transferase
(GST), versterkt groen fluorescent eiwit (EGFP), of hemagglutinine (HA).
A. Strategie
5
[0245] DNA-fragmenten die overeenkomen met PDZ-domein bevattende genen
werden gegenereerd door RT-PCR van RNA van een bibüotheek van RNA dat is ver-
kregen van afzonderlijke ceUijnen (CLONTECH Cat# K4000-1) door het gebruik van
wiUekeurige (oügo-nucleotide) primers (Invitrogen Cat.# 48190011). DNA fragmenten
10 die overeenkomen met PDZ-domein bevattende genen of delen van PDZ-domein be-
vattende genen werden gegenereerd door standaard PCR door het gebruik van de ge-
zuiverde cDNA-fragmenten van hierboven en specifieke primers (zie Tabel 6). Primers
die werden gebruikt werden ontworpen voor het vormen van restrictie nuclease herken-
ningsplaatsen aan de uiteinden van het PCR-fragment om klonering van die fragmenten
15 in geschikte expressievectoren mogeUjk te maken. Volgend op PCR werden DNA-
monsters onderworpen aan agarosegel-elektroforese. Banden die overeenkomen met de
verwachte grote werden uitgesneden. DNA werd geëxtraheerd door Sephaglas Band
Prep Kit (Amersham Pharmacia Cat# 27-9285-01) en gedigereerd met het juiste res-
trictie-endonuclease. Gedigereerde DNA-monsters werden nog één keer gezuiverd door
20 gelelektroforese, volgens hetzelfde protocol dat hierboven is gebruikt. Gezuiverde
DNA-fragmenten werden tezamen geprecipiteerd en geUgeerd met de juiste geüneari-
seerde vector. Na transformatie in E. coli werden bacteriële kolonies gescreend door
kolonie PCR en restrictiedigestie op de aanwezigheid en juiste oriëntatie van het insert.
Positieve klonen werden beent in een vloeibare kweek voor DNA-zuivering op grote
25 schaal. Van het insert en de flankerende vectorplaatsen van het gezuiverde plasmide
DNA werd de sequentie geanalyseerd voor het bevestigen van de juiste sequentie van
fragmenten en overgangen tussen de vectoren en fusie-eiwitten.
30
B. Vectoren:
[0246] Alle PDZ-domein-bevattende genen werden gekloneerd in de vector
pGEX-3X (Amersham Pharmacia #27-4803-01, Genemed Acc#U13852, GI#595717),
die een tac promoter, GST, Factor Xa, ß-lactamase en lac-repressor bevat
EU 1 537 415 Bl
2.MAR.2009 15=50 NED. OCTROOIBUREAU 43703527580- NO.059 P.29
ACCOUNTS
114
[0247] De aminozuursequentie van het coderende gebied van pGEX-3X waaronder
GST, Factor Xa en de meerdere kloneringsplaats is hieronder opgesomd. Merk op dat
linkersequenties tussen de gekloneerde inserts en GST-Factor Xa variëren afhankeUjk
van het restrictie-endonuclease die is gebruikt voor klonering. Aminozuren in het ge-
5 translateerde gebied hieronder die kunnen veranderen afhankeUjk van de insertie die is
gebruikt zijn aangegeven in kleine letters en zijn opgenomen als te zijn veranderd in de
sequentie van het construct dat is opgesomd in (C).
aa 1-aa 232:
10 MSPJLGYWKKGLVQPTRLII.EYLEEKYEEHLYERDEGDKWRNKKFELGLEF
PNLPMIDGDVKLTQSMADRYIADKHNMLGGCPKERAEISMLEGAVLDIRY
GVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDI4VTHPDFML
YDALDVVLYMDPMCLDAFPKLVCTKKRIEAIPQroKYLKSSKYlAWPLQGW
QATFGGGDHPPKSDLIEGRgipgnss (SEQ ID NO: 272)
15
[0248] In aanvulling werd TAX interactie vertonend eiwit 1 (TIP1) , in het geheel
of gedeelteUjk, gekloneerd in veel andere expressievectoren, waaronder maar niet be-
perkt tot CD5y, PEAK10 (beide verschaft door het laboratorium van Dr. Brian Seed
aan de Harvard University en gegenereerd door recombinante DNA-technologie, die
20 een IgG-gebied bevatten) en MIN (een derivaat van MSCV, die 1RES en NGFR bevat,
gegenereerd door recombinante DNA-technologie).
C Constructen:
25 [0249] Primers die zijn gebruikt voor het genereren van DNA-fragmenten door
PCR zijn in Tabel 6 opgesomd. PCR-primer combinaties en restrictieplaatsen voor in-
sert en vector zijn hieronder opgesomd, tezamen met aminozuur translatie voor insert
en restrictieplaatsen. Niet-natieve aminozuursequenties zijn in kleine letter getoond.
30
EU 1537 415 Bl
2.MAR.2009 15:50
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.059
P. 30
115
Tabel 6. Primers die zijn gebruikt bij de klonering van DLG 1 (domein 2 van 3), MAGI
1 (domein 2 van 6) en TIP1 in representatieve expressievectoren
ID# (naam primer) Sequentie primer Beschrijving SEQ ID
1928 (654DL1 2F) AATGGGGATCCAGC TCATTAAAGG Heenwaartse (5' naar 3') primer die overeenkomt met DLG1, domein 2 van 3. Genereerteen BamHI stroomopwaarts (5') van de grens van PDZ. Wordt gebruikt voor klonering in pGEX3x 273
1929 (655DL1 2R) ATACATACTTGTGG AATTCGCCAC Teruggaande (3' naar 5') primer die overeenkomt met DLG1, domein 2 van 3. Genereert een EcoRI plaats stroomafwaarts (3') van de grens van PDZ. Wordt gebruikt voor klonering in pGEX-3x, 274
1453 (435BAF) CACGGATCCCTTCTG AGTTGAAAGGC Heenwaartse (5' naar 3') primer dje overeenkomt met MAGI 1, domein 2 van 6. Genereert een BamHI plaats stroomopwaarts (5') van de grens van PDZ. Wordt gebruikt voor klonering in pGEX-3x 275
1454 (436BAR) TATGAATTCCATCTG GaTCAAAAGGCAATG Teruggaande (3' naar 5') primer die overeenkomt met MAGI 1, domein 2 van 6. Genereert een EcoRI plaats stroomafwaarts (3') van dc grens van PDZ. Wordt gebruikt voor klonering in pGEX-3x. 276
399 (86TAF) CAGGGATCCAAAGA GTTGAAATTCACAA GC Heenwaartse (5' naar 3') primer die overeenkomt met TIP1. Genereert een BamHI plaats stroomopwaarts (5') van de grens van PDZ. Wordt gebruikt voor klonering in pGEX-3x 277
400 (87TAR) ACGGAATTCTGCAG CGACTGCCGCGTC Teruggaande (3' naar 5') primer die overeenkomt met TIP1. Genereert een EcoRI plaats stroomafwaarts (3') van de grens van PDZ. Wordt gebruikt voor klonering in pGEX-3X. 278
1319 (TIP G5-1) AGGATCCAGATGTC CTACATCCC Heenwaartse (5' naar 3') primer die overeenkomt met TIP1, genereert een BamHI plaats stroomopwaarts (5') van het startcodon. Wordt gebruikt voor klonering in pGEX-3X 279
1320 (TIP G3-1) GGAATTCATGGACT GCTGCACGG Teruggaande (3' naar 5') primer die overeenkomt met TIP1. Genereert een EcoRI plaats stroomafwaarts (3') van het stopcodon. Wordt gebruikt voor klonering in pGEX-3X, 280
2753 (1109TIF) AGAGAATTCTCGAG ATGTCCTACATCCC Heenwaartse (5' naar 3') primer die overeenkomt met TIP1. Genereert een EcoRI plaats 281
EU 1537 415 Bl
2.MAR.2009 16:26
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.074
P.2
116
ID# (naam primer) Sequentie primer Beschrijving SEQ ID
stroomopwaarts (5') van het startcodon. Wordt gebruikt voor klonering in MIN
2762 (1117TIR) TGGGAATTCCTAGG ACAGCATGGACTG Teruggaande (3' naar 5') primer die overeenkomt met TIP1. Genereert een EcoRI plaats stroomafwaarts (3') van het stopcodon. Wordt gebruikt voor klonering in MIN. 282
2584 (1080TIP) CTAGGATCCGGGCC AGCCGGTCACC Heenwaartse (5' naar 3') primer die overeenkomt met TIP1. Genereert een BamHI plaats stroomopwaarts (5') van de grens van PDZ. Wordt gebruikt voor klonering in PEAK10 of CD5v. 283
2585 (1081TIR) GACGGATCCCCCTG CTGCACGGCCTTCTG Teruggaande (3' naar 5') primer die overeenkomt met UPI. Genereert een Bam Hl plaats stroomafwaarts (3') van de grens van PDZ. Wordt gebruikt voor klonering in PEAK10 of CD5y. 284
2586 (1082TIR) GACGAATTCCCCTG CTGCACGGCCTTCTG Teruggaande (3' naar 5') primer die overeenkomt met TIP1. Genereert een EcoRI plaats stroomafwaarts (3') van de grens van PDZ. Wordt gebruikt voor klonering in PEAKlO of CD5y. 285
2587 (1083TIF) CTAGAATTCGGGCC AGCCGGTCACC Heenwaartse (5' naar 3') primer die overeenkomt met TIP1. Genereert een EcoRI plaats stroomopwaarts (5') van de grens van PDZ. Wordt gebruikt voor klonering in PEAKlO of CD5v. 286
1. DLG 1. PDZ domein 2 van 3:
Acc#: U13897
GI#: 55S437
5 ? Construct DLG 1, PDZ domein 2 van 3-pGEX-3X
Primers: 1928 & 1929
Kloneringsplaatsen van de vector (573'): Bam Hl/EcoRl
Kloneringsplaatsen van het insert (573'): BamHl/EcoRl
10 aa 1-aa 88
giqLIKGPKGIJ3FSIAGGVGNQHIPGDNSIYVTKnEGGAAHKDGKLQIGDKL-
IAV>WVCl£EVTHEEAVTALKNTSDFVYLKVAnss (SEQ ID NO: 287)
EU 1537 415 Bl
2.MAR.2009 16:26 NED. OCTROOIBUREAU 43703527580 NO.074 P.3
ACCOUNTS
117
2. MAGI 1. PDZ domein 2 van 6:
Acc#: AB010894
GI#: 3370997
? Construct: MAGI 1, PDZ domein 2 van 6-pGEX-3X
5 Primers: 1453 & 1454
Kloneringsplaatsen van de vector (573'): Bam Hl/EcoRl
Kloneringsplaatsen van het insert (573'): BamHl/EcoRl
aa 1-aa 108
10 giPSEOCGKFIHTKLRKSSRGFGFTVVGGDEPDEFLQIKSLVLD
GPAALDGKMETGDVrVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCRGY-
PLPFDPDgihrd (SEQ ID NO: 288)
3. TAX Interactie-vertonend eiwit CTIP1):
15 Acc#: AF028823.2
GI#:11908159
? Construct: TTP1, PDZ domein 1 van l-pGEX-3X
Primers: 399 &. 400
Kloneringsplaatsen van de vector (573'): Bam Hl/EcoRl
20 Kloneringsplaatsen van het insert (573'): BamHl/EcoRl
aa 1- aa 107
giQRVETHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIY
VTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRL TKRSEEV-
25 VRLLVTRQSLQnss (SEQ ID NO: 289)
? Construct: TIPl-pGEX-3X
Primers: 1319 & 1320
Kloneringsplaatsen van de vector (573'): Bam Hl/EcoRl
30 Kloneringsplaatsen van het insert (573'): Bam Hl/EcoRl
EU 1 537 415 Bl
2.MAR.2009 16:26 NED. OCTROOIBUREAU 43703527580 NO.074 P.4
ACCOUNTS
118
aa 1-aa 128
giqMSYIPGQPVTAWQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFS
EDKTDKGIYVTTIVSEGGPAEIAGLQIGDKMQVNGWDMTMVTHDQA
RKRLTKRSEEVVRLLVTRQSLQKAVQQSMnss (SEQ ID NO: 290)
? Construct: TIP1-M1N
Primers: 2753 & 2762
Kloneringsplaatsen van de vector (573'): EcoRI/EcoRI
Kloneringsplaatsen van het insert (573'): EcoRI/EcoRI
10
aa 1-aa 129
agUEMSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQD
PSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNG
WDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSM LS
15 (SEQ ID NO: 291)
? Construct: TlPl-CD5y
Primers: 2584 & 2585
Kloneringsplaatsen van de vector (573'): Bam Hl/Bam HI
20 Kloneringsplaatsen van het insert (573'): Bam Hl/Bam HI
aa 1-aa 122
adPGQPVTAVVQRVElHKLRQGENLILGFSIGGGlDQDPSQNPF
SEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTM VTHDQAR-
25 KRLTKRSEEWRLLVTRQSLQKAVQQSdpe (SEQ FD NO: 292)
D. Productie en zuivering van GST fusie-eiwit
[0250] De constructen die gebruik maken van de pGEX-3X expressievector, wer-
30 den gebruikt voor het maken van fusie-eiwitten volgens het protocol dat uiteengezet is
in het GST Fusion System, Tweede editie, Revision 2, Pharmacia Biotech. Method II
en werd geoptimaliseerd voor een IL LgPP.
EU 1537 415 Bl
2.MAR.2009 16:27 NED. OCTROOIBUREAU 43703527580 NO.074 P.5
ACCOUNTS
119
[0251] Gezuiverd DNA werd getransformeerd in E coli en toegestaan te groeien
tot een ODooo van 0,4-0,8 (600A.). Eiwitexpressie werd gedurende 1-2 uur geïnduceerd
door toevoeging van IPTG aan de celkweek. Cellen werden geoogst en gelyseerd. Ly-
saat werd verzameld en GS4B korrels (Pharmacia Cat# 17-0756-01) werden toege-
voegd voor het binden van GST fusie-eiwitten. Korrels werden geïsoleerd en GST fu-
sie-eiwitten werden geëlueerd met GEB D. Gezuiverde eiwitten werden opgeslagen in
GEBnbij-80°C.
[0252] Gezuiverde eiwitten werden gebruikt voor ELISA-gebaseerde testen en
productie van antilichaam.
10
E. Productie en zuivering van IgG fusie-eiwit
[0253] De constructen die gebruik maken van de expressievectoren CD5gamma of
PeaklOIgG werden gebruikt voor het maken van fusie-eiwit. Gezuiverde DNA-vecto-
15 ren werden getransfecteerd in 293 EBNA T-cellen onder standaard kweek-omstandig-
heden (DMEM + 10% FCS) door het gebruik van de standaard calciumfosfaat precipi-
tatiewerkwijzen (Sambrook, Fritsch en Maniatis, Cold Spring Harbor Press) bij een
verhouding van -1 |xg vector DNA voor 1 miljoen cellen. Deze vector resulteert in een
fusie-eiwit dat wordt uitgescheiden in het kweekmedium. Op transiënte wijze getrans-
20 fecteerde cellen worden getest op piekexpressie en kweekmedia die het fusie-eiwit be-
vatten wordt verzameld bij die maxima (gewoonlijk 1-2 dagen). Fusie-eiwitten worden
ofwel gezuiverd door het gebruik van Proteïne A chromatografie of direct bevroren in
het kweekmedium zonder toevoeging.
25 VOORBEELD 5
TIP-1 BINDT OP SPECIFIEKE WIJZE AAN ONCOGENE E6-EIWTJTEN
A. Abstract
30 [0254] Een experiment werd uitgevoerd om te tonen en om te bevestigen dat PDZ-
domeinen alleen de C-uiteinden van oncogene HPV E6-eiwitten met de volledige
lengte herkennen en niet niet-oncogene E6 varianten. Dit valideert de werkwijze van
het gebruik van peptiden die de Pl^sequenties van E6-eiwitten vertonen door te vragen
EU 1537 415 Bl
2.MAR.2009 16:27
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.074
P.6
10
15
120
of binding van PDZ kan worden gereproduceerd door het gebruik van E6 fusie-eiwitten
met de volledige lengte.
[0255] In het kort werden GST-E6 fusie-eiwitten geconstrueerd zoals is beschre-
ven in Voorbeeld 3 die overeenkomen met de eiwitsequentie met de volledige lengte
van E6 van HPV 18 (oncogeen) en HPV 11 (niet-oncogeen). Door het gebruik van een
gemodificeerde ELISA-test werd binding van een TIP-TIP-IgG fusie-eiwit (twee ko-
pieën van het TIP-1 PDZ domein gefuseerd aan het constante gebied van hlgG, zuive-
ring van fusie-eiwit gedeeltelijk beschreven in Voorbeeld 4) aan deze twee E6 varian-
ten bepaald.
[0256] Een daaropvolgend experiment is ook getoond om te tonen dat de test op
binding aan E6 door het gebruik van GST-Tip of GST-Magi fusie-eiwitten niet aan-
zienlijk wordt beïnvloed door incubatie bij 4°C of bij kamertemperamur (RT).
B. Gemodificeerde ELISA werkwijze
Reagens en materialen
[0257]
20
25
30
Nunc Polysorp immunoplaat met 96 putjes (Nunc cat#62409-005) (Het is
van Maxisorp platen getoond dat ze een hoger achtergrond signaal hebben)
PBS pH 7,4 (Gibco BRL cat#l 6777-148) of AVC fosfaat-gebufferde
zoutoplossing, 8 gram NaCl, 0,29 gram KCl, 1,44 gram Na2HP04, 0,24
gram KH2P04, voeg H20 toe tot 1 liter en pH 7,4; 0,2 micron filter
2% BSA/PBS (10 gram runderserumalbumine, fractie V (ICN Biomedicals
cat#IC15142983) in 500 ml PBS
Anti-GST mAb van geit voorraad bij 5 mg/ml, bewaar bij 4°C, (Amersham
Pharmacia cat#27-4577-01), verdun 1 : 1000 in PBS, uiteindelijke
concentratie 5 ug/ml
Wasbuffer, 0,2% Tween 20 in 50 mM Tris pH 8,0
TMB klaar voor gebruik (Dako cat#S 1600)
IMH2SO4
12w multikanaal pipet,
50 ml reagens reservoirs,
EU 1 537 415 Bl
2.MAR.2009 16:27 NED. OCTROOIBUREAU 43703527580 NO.074 P.7
ACCOUNTS
121
? Polypropyleen konische buisjes van 15 ml
anti E6HPV18 antilichaam (OEM Sciences)
? Anti-hlg-HRP (Biomeda)
5 Protocol
[0258]
1) Bekleed de plaat met 5 ug/ml GST-E6 fusie-eiwit, gedurende de nacht bij
10 4°C,
2) Verwijder de eiwitten en tik droog
3) Blokkeren - Voeg 200 ul per putje van 2% BSA/PBS toe, gedurende 2 uur
bij 4°C
4) Bereid PDZ-eiwitten (50:50 mengsel van supernatant van TIP-TTP-IgG
15 transfectie en 2% BSA/PBS)
5) Was 3X met koude PBS
6) Voeg PDZ-eiwit toe in stap 7 of anti-E6 Ab bij 1 ng/ml in 2% BSA/PBS (of
anti- GST Ab als controle)
7) Was 3X met koude PBS
20 8) Voeg de juiste concentratie van enzym-geconjugeerd detectie Ab toe (anti-
hlgG-HRP, anti-geit-HRP of anti-muis-HRP) 100 nl per putje op ijs, 20
minuten bij 4°C
9) Zet de plaat reader aan en maak files gereed
10) Was 5X met Tween wasbuffer, voorkom luchtbellen
25 11) Gebruik handschoenen, voeg TMB-substraat toe bij 100 ul per putje
incubeer in het donker bij kamertemperatuur
controleer de plaat periodiek (5,10 & 20 minuten)
maak vroege aflezingen, indien nodig, bij 650 nm (blauw)
30 - stop de reactie na 30 minuten met 100 ul van 1 M H2S04
maak uiteindelijke aflezing bij 450 nm (geel)
EU 1537 415 Bl
2.MAR.2009 16:28 NED. OCTROOIBUREAU 43703527580 NO.074 P.8
ACCOUNTS
122
C. Resultaten van bindingsexperimenten
[0259] TIP-1, een representatief PDZ-domein dat de meeste oncogene E6 PL's
bindt (Voorbeeld 2), is in staat om op specifieke wijze PL's van oncogene E6 varianten
5 met de volledige lengte (HPV18-E6) te herkennen zonder te binden aan niet-oncogene
varianten (HPV11-E6; Figuur 1). Zelfs ongezuiverd TIP-TTP-IgG fusie-eiwit is boven-
dien in staat GST-HPV18E6 fusie-eiwit te herkennen bij niveaus die vergelijkbaar zijn
voor een antilichaam dat is gegenereerd tegen HPV18-E6. Antilichamen tegen GST
werden gebruikt om te bevestigen dat GST-HPV18E6 en GST-HPVl 1E6 op uniforme
10 wijze werden uitgeplaat (gegevens niet getoond).
[0260] Deze test is bovendien krachtig en de off-rates zijn stabiel genoeg dat de
incubatiestappen van deze test kunnen worden uitgevoerd bij 4°C of kamertemperatuur.
Weinig verschil in signaal wordt waargenomen tussen de twee temperaturen voor bin-
ding van ofwel GST-Magil of GST-TIP1 aan E6 (Figuur 2).
15 [0261] E6-activiteit kan verder worden beoordeeld door het vermogen ervan om te
binden aan DNA of om afbraak van p53 mogelijk te maken in de aanwezigheid van een
lysaat, Zn2+ binding, enzovoort.
VOORBEELD 6
20 EC50 BEPALINGEN VOOR PDZ-DOMEIN INTERACTIES MET HPV16 E6
[0262] Door het gebruik van de G-test die hierboven is beschreven werden
verscheidene GST-PDZ-domein fusie-eiwitten getest voor het bepalen van de relatieve
sterkte van binding ervan aan het PL van het HPV16 Eo^eiwit Peptide dat overeen-
25 komt met het PL van HPV16 E6 werd getitreerd tegen een constante hoeveelheid van
GST-PDZ-domein fusie en de resultaten zijn hieronder getoond. Deze resultaten tonen
dat alhoewel een aantal van PDZ-domeinen het E6-eiwit van HPV16 kunnen binden,
het eerste functionele domein van MAGI 1 (domein 2 in deze specificatie) het meest
sterk bindt, dat dit domein het meest geschikt maakt voor diagnostische doeleinden. Dit
30 is onverwacht in het bijzonder in samenhang met dat MAGI 1 het enige PDZ-domein
bevattende eiwit is waarvan is getoond dat het bindt aan alle klassen van oncogene E6-
eiwitten die zijn geïdentificeerd. Tezamen suggereren deze resultaten dat MAGI 1 een
bruikbaar vangend/detecterend middel is voor oncogene HPV-infecties.
EU 1537 415 Bl
2.MAR.2009 16:28
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.074
P.9
123
Tabel 7: EC50-waarden voor HPV16 E6-eiwit met verscheidene PDZ-domeinen
PDZ-gen EC5(nuM] RNA expressie (cervicale cellijnen)
MagilC (PDZ2) 0,056 ?H-
Magi3 (PDZ1) 0,31 Neg.
SAST1 KIAA 0,58 Neg.
TIP1 0,75 +++
VARTUL 0,94 +
DLG1 (PDZ2) ND T"f?"»P
PSD95 (PDZ1-3) 1.0 ND
SAST2 1,2 ND
DLG2 (PDZ3) 1,6 ND
DLG3 (PDZ1-2) 3,8 ND
PDS95 (PDZ2) 6,8 ND
SIP1 (PDZ1) 7,5 ND
Tabel 7 legenda: ND = Niet uitgevoerd
VOORBEELD 7
5 PRODUCTIE VAN ANTILICHAMEN TEGEN GEZUIVERDE E6 FUSIE-
EIWTTTEN VAN HPV18
[0263] Teneinde de toegevoegde voordelen van een sandwich ELISA-gebaseerde
diagnostische test voor oncogene HPV-infectie te verkrijgen zouden antilichamen met
10 hoge affiniteit die specifiek zijn voor E6-eiwitten moeten worden gegenereerd. Op ide-
ale wijze zouden monoklonale antilichamen kunnen worden gegenereerd van deze die-
ren om een op continue wijze vernieuwbare bron voor de diagnostische test te hebben.
[0264] Balb/c muizen werden geïnjecteerd met 25 ng van bacterieel gezuiverd
GST-HPV18E6-eiwit bij tussentijden van 5 dagen (Josman Labs). Sera van deze mui-
15 zen werden 3 dagen na elke injectie van antigeen verzameld en getest op reactiviteit
met GST-HPV18E6 (het immunogeen) of GST alleen volgend op anti-GST lediging
(Pharmacia protocol). De resultaten met het gebruik van sera die zijn verzameld op dag
28 zijn getoond in Figuur 3. De sera van deze muis reageert met bacterieel gezuiverd
GST-HPV18-E6-eiwit maar reageert niet met GST alleen. Dit dier is een goede gega-
20 digde waarvan een monoklonaal antilichaam kan worden gegenereerd door standaard
werkwijzen.
EU 1537 415 Bl
2.MAR.2009 16:29
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.074
P. 10
10
15
20
124
VOORBEELD 8
PATHOGENE PL-EIWriTEN
[0265] Veel andere eiwitten van pathogenen kunnen worden gedetecteerd door het
gebruik van eiwitten of verbindingen die zijn gericht voor detectie van een PDZ:PL
interactie. Tabel 8 bevat enige illustratieve eiwitten die zouden kunnen worden gede-
tecteerd door het gebruik van technologie die hierin is beschreven, maar is op geen en-
kele wijze als beperkend bedoeld.
Tabel 8; Illustratieve pathogenen die kunnen worden gebruikt voor PDZ:PL diagnostiek
Pathogeen Eiwit Gi of ACC nummer PL/PDZ
Adenovirus B4 19263371 PL
Hepatitis B virus Proteïne X 1175046 PL
Humane T-cel loukemievirus TAX 6983836 PL
Herpesvirus DNA-polymerase 18307584 PL
Herpesvirus US2 9629443 PL
VOORBEELD 9
KWANTIFICERING VAN ENDOGEEN E6-EIW1T IN CELLEN DIE ZUN
GEÏNFECTEERD MET HPV16
A) Abstract:
[0266] Experimenten werden ontworpen en uitgevoerd voor het bepalen van de
hoeveelheden van endogeen E6-eiwit in HPV16-geïnfecteerde cervicale kanker-cellij-
nen. Resultaten tonen dat HPV16-geïnfecteerde kankercellijnen in de orde van 10.000
tot 100.000 moleculen E6 bevatten. Uit deze vinding wordt geconcludeerd dat E6-eiwit
kan worden gebruikt als een diagnostische of prognostische merker voor cellulaire
HPV-infectie. Gebruik van remmers van een route van eiwitafbraak kunnen een derge-
lijke test bewerkstelligen.
25
EU 1537 415 Bl
2.MAR.2009 16:29 NED. OCTROOIBUREAU 43703527580 NO.074 P.il
ACCOUNTS
125
B) Werkwijzen:
Immunoprecipitatie van E6-eiwit
5 [0267] HPVl6-ge'mfecteerde cervicale kankercellijnen SiHa en CasKi worden ge-
wassen met koude PBS en geresuspendeerd in HEPES lysisbuffer (50 mM HEPES pH
7,4, 150 mM NaCl, 10% glycerol, 0,5% triton X-100, 1 mg/ml BSA, één tablet pro-
tease-remmer cocktail (Roche) en 1 mM PMSF) bij 2xl07 cellen/ml. Lysis verloopt
gedurende 30 minuten op ijs en lysaten worden geklaard door centrifugatie bij 14.000x
10 g gedurende 5 minuten bij 4°C. E6-eiwitten worden immunogeprecipiteerd met een
anti-E6 antilichaam van muis (kloon 6F4) en proteïne-G korrels (Pharmacia, Piscata-
way, NJ). Na 2 uur incubatie bij 4°C onder rotatie worden korrels 3 keer gewassen met
wasbuffer [50 mM HEPES pH 7,4, 150 mM NaCl, 10% glycerol, 0,1% Triton X-100,
protease-remmer cocktail (CALBIOCHEM), 1 mM PMSF]. Pellets worden geresus-
15 pendeerd in SDS-PAGE monsterbuffer en geanalyseerd door iinmunoblotting door het
gebruik van anti-E6 antilichaam 6F4 en anti-muis-IgG-HRP geconjugeerd (Jackson
Immune Research).
Detectie van E6-eiwit van lysaten van cervicale kankercellen door Western technolo-
20 gie:
[0268] SiHa en CasKi cervicale kankercellijnen werden gedurende 30 minuten op
ijs gelyseerd bij 2xl07 cellen/ml in lysisbuffer. Lysaten die overeenkomen met bij be-
nadering IO6 cellen zijn direct ontbonden op een 12% 12% SDS-PAGE gel gevolgd
25 door overdracht naar een PVDF membraan. E6-eiwitten werden gedetecteerd met anti-
E6 HPV16 antilichaam 6F4 en anti-muis-IgG-HRP geconjugeerd (Jackson Immuno
Research).
30
C) Resultaten:
[0269] Voor het bepalen van het ogenschijnlijke molecuulgewicht van endogeen
E6-eiwit zoals het aanwezig is in cervicale kankercellen bij infectie met HPV 16 en om
te verzekeren dat een anti-E6 monoklonaal antilichaam-specifieke band die wordt
EU 1537 415 Bl
2.MAR.2009 16=29 NED. OCTROOIBUREAU 43703527580 NO.074 P.12
ACCOUNTS
126
waargenomen bij PAGE viraal E6-eiwit vertegenwoordigt, werden 293 EBNA-T-cellen
getransfecteerd met een construct dat ongemerkt E6-eiwit van HPV type 16 tot expres-
sie brengt. Cellysaten werden van die cellen bereid en HPV-ge'mfecteerde SiHa cervi-
cale kankercellen. E6-eiwit van beide lysaten (getransfecteerd en HPV geïnfecteerd)
5 werd gèünmunoprecipiteerd door het gebruik van een anti-E6-specifiek monoklonaal
antilichaam. Beide lysaten werden zij aan zij geanalyseerd door het gebruik van PAGE
technologie (Figuur 6). De E6-specifieke band die werd verkregen voor getransfecteerd
E6 migreert bij PAGE op hetzelfde niveau als de anti-E6 antilichaam specifieke band
van SiHa cervicale kankercellijnen, dat aldus zeer sterk suggereert dat het product dat
10 is geïmmunoprecipiteerd met anti-E6-specifiek monoklonaal antilichaam viraal E6-ei-
wit vertegenwoordigt. Door het gebruik van het specifieke E6 monoklonale antilichaam
werd een band van dezelfde grootte gedetecteerd in HPV16-geïnfecteerde cervicale
kankercel type CasKi (Figuur 7).
[0270] Bij een andere experimentele werkwijze werd endogeen viraal E6-eiwit van
15 HPV16-geïhfecteerde cervicale kankercellijn SiHa en CasKi direct gedetecteerd van de
cellysaten ervan (Figuur 7). Banden die afhankelijk waren van E6-specifiek monoklo-
naal antilichaam migreerden op dezelfde wijze als de band voor cellen die zijn getrans-
fecteerd met voor E6-coderende vector.
[0271] Om te testen of stabiliteit van E6 in vivo kan worden verhoogd door het op
20 selectieve wijze blokkeren van proteasoom die is betrokken bij eiwitafbraak werden
cellysaten van sommige monsters behandeld met proteasoomremmer MG132. Ih die
monsters is de E6-specifieke band ongeveer 2-3 keer meer intens. Dit toont dat de toe-
voeging van een juist mengsel van eiwitafbraak-route-remmende middelen kan worden
gebruikt voor het verhogen van het signaal dat specifiek is voor E6-eiwit door het ver-
25 sterken van de tijdelijke accumulatie ervan in cellen.
[0272] Hoeveelheden van E6-eiwit in lysaten werden gemeten door het vergelijken
van E6-specifiek signaal in PAGE met signalen die worden verkregen door MBP-E6
(HPV16) fusie-eiwit dat op dezelfde gel is opgebracht. In sommige gevallen werd
MBP-E6 fusie-eiwit gedigereerd met factor X voor het vrijmaken van alleen het E6-
30 deel. Studies die de signaalintensiteit vergelijken toonden dat van cervicale kanker af-
komstige ceUijnen die zijn geïnjecteerd met HPV16 (SiHa, CasKi) E6 bevatten bij een
concentratie van 0,3 tot 3 ng per 1 x 106 cellen. Het wordt geconcludeerd dat hoeveel-
EU 1537 415 Bl
2.MAR.2009 16:30 NED. OCTROOIBUREAU 43703527580 NO.074 P.13
ACCOUNTS
127
heden en stabiliteit van E6 zodanig zijn dat detectie door een E6-specifieke (ELISA-)
test uitvoerbaar zal zijn.
VOORBEELD 10
ONCOGENE E6-PL-DETECTOR MOLECULEN BINDEN OP SELECTIEVE
WIJZE ENDOGENE HPV6-E6 EIWITTEN DIE AANWEZIG ZUN IN CEL-
LYSATEN EN KUNNEN WORDEN GEBRUIKT VOOR HET SCHEIDEN VAN
ENDOGEEN E6-EIWTT VAN ANDERE BESTANDDELEN DIE AANWEZIG ZUN
INEENCELLYSAAT
10
A) Abstract
[0273] Experimenten werden uitgevoerd om te testen of oncogeen E6-PL-detector
op selectieve wijze zal binden aan endogeen E6 van cellen die zijn getransfecteerd met
15 voor E6 coderende vector. Het werd bovendien getest of de oncogene E6-PL-detector
kan worden gebruikt voor het scheiden van E6 van andere moleculen in het cellysaat
volgend op binding. Vindingen tonen dat oncogeen E6-PL-detector selectief is en kan
worden toegepast voor het scheiden van E6-eiwit van het complexe mengsel van mole-
culen van het cellysaat.
20
B) Werkwijzen
Verwijderen van E6-eiwü met recombinante PDZ-eiwitten:
25 [0274] GST-PDZ fusie-eiwitten (d.w.z. Magil PDZ domein #1, Syn2bp, Magi3
PDZ domein # 1, Tipl, PSD-95 PDZ domein # 2 en SAST1 werden getest in experi-
menten voor het verwijderen van E6. In het kort werd 10 ug van recombinante GST-
PDZ eiwitten geïncubeerd met 30 ul van glutathion-sephaiose korrels in 1 ml buffer
[50 mM HEPES pH 7,4, 150 mM NaCl, 10% glycerol, 0,1% Triton X-100, proteaser-
30 emmer cocktail, 1 mM PMSF] gedurende 1 uur bij 4°C onder rotatie. Daaropvolgend
werden cellysaten van IO7 293-cellen die op transiënte wijze zijn getransfecteerd met
ofwel pMKit-HA-HPV16-E6 of pMKit-HA vector alleen gedurende 3 uur bij 4°C on-
der rotatie geïncubeerd met de korrels waar aan de PDZ-eiwitten zijn gebonden. Kor-
EU 1537 415 Bl
2.MAR.2009 16=30 NED. OCTROOIBUREAU 43703527580 NO.074 P.14
ACCOUNTS
128
reis werden gewassen en geanalyseerd in 12% SDS-PAGE gelelektroforese gevolgd
door Western blotting. Membranen werden gemerkt met biotine geconjugeerde anti-
HA antilichamen (klonen 3F10, of 12CA5, Boehringer Mannheim) en HRP-Streptavi-
dine (Zymed).
5 [0275] Als alternatief werden cellysaten van 293-cellen die op transiënte wijze zijn
getransfecteerd met pmKit-HA, pmkit-HPV16-HA-E6 of pmKit-HA-HPV16 E6-APL,
geïncubeerd met recombinant GST-Magil-PDZ domein 1 eiwit en geïmmobiliseerd op
glutathion-sepharose korrels en gebonden fracties werden met anti-HA antilichamen
aan immunoblotting onderworpen. In parallel werden lysaten immunogeprecipiteerd en
10 gedetecteerd met anti-HA antilichamen.
C) Resultaten
[0276] G-test PDZ-E6-PL bindende studies en de bepaling van experimentele bin-
15 dingsaffiniteiten van de E6-PDZ interacties suggereerden gegadigde PDZ-domeinen
om te worden getest voor de manipulatie van een oncogeen E6-PL detector. In een "ex-
periment van verwijdering" werden vijf verschillende PDZ-domeinen (Tipl; Magil
domein 1; Sast2; Psd95 domein 2; Synaptojanin-2 bindend eiwit) getest voor verwijde-
ren van endogeen tot overexpressie gebracht E6 van cellysaat. Lysaten van cellen die
20 zijn getransfecteerd met HA-gemerkte E6 HPV-16 werden geïncubeerd met GST-PDZ
fusie-eiwit dat de PDZ-domeinen van hierboven vertoont gebonden aan Sépharose kor-
rels (Figuur 5). Controle celmonsters werden getransfecteerd met constructen die HA
tot expressie brengen. Detectie met anti-HA monoklonaal antilichaam toont dat E6 op
selectieve wijze wordt verwijderd van cellysaten door middel van het PDZ-domein dat
25 wordt weergegeven door de oncogene E6-PL-detector van alle vijf GST-PDZ eiwitten
die zijn getest (Tipl; Magil domein 1; Sast2; Psd95 domein 2; Synaptojanin-2 bindend
eiwit). Resultaten die zijn getoond in Figuur 5B tonen dat Magi 1-PDZ domein 1 met
HA-E6 associeert maar niet met HA-E6APL (die de 3 C-eindstandige aminozuren
mist). Deze werkwijze kan worden gebruikt om te bepalen of een specifiek PDZ^-do-
30 mein het vermogen heeft om op specifieke wijze E6 te binden. Het wordt geconclu-
deerd dat competitie door mogelijke PDZ-bindende eiwitten die worden gepresenteerd
door het complexe mengsel van cellysaten en E6 voor binding aan PDZ's kan worden
EU 1537 415 Bl
2.MAR.2009 16:31 NED. OCTROOIBUREAU 43703527580 NO.074 P.15
ACCOUNTS
129
verschoven naar selectieve binding van E6 door juiste keuze van het specifieke PDZ-
domein dat de oncogene E6-PL-detector vormt.
VOORBEELD 11
ENDOGEEN E6-EIWTT VAN HPV-GEÏNFECTEERDE CERVICALE KANKER-
CELLDNEN KAN WORDEN GEDETECTEERD IN EEN SANDWICH ELISA
DOOR MIDDEL VAN HET ONCOGEEN E6-PL DETECTOR MOLECUUL
10
A) Abstract:
[0277] Experimenten zijn beschreven waarin de oncogene E6-PL detector is ge-
bruikt voor het op selectieve wijze detecteren van de aanwezigheid van E6-eiwit in
HPV-geïnfecteerde cellen door middel van een sandwich ELISA. Het specifieke van-
gen van oncogeen E6 maar niet van niet-oncogeen E6 toont dat de PDZ-gebaseerde
15 oncogene E6-PL detector kan worden toegepast voor een E6-detectie-gebaseerde dia-
gnostische test voor HPV-infectie en/of een test op baarmoederhalskanker.
B) Werkwijzen:
20 [0278] Sandwich type 1 ELISA: Anti-E6 antilichaam wordt bekleed op een Poly-
sorp of Maxysorp ELISA plaat met 96 putjes bij 5 ug/ml in PBS (100 ul/putje) gedu-
rende de nacht bij 4°C. Platen werden gewassen met PBS en geblokkeerd met 200 ul
PBS/2% BSA gedurende 2 uur bij 4°C. Cellysaten verdund in PBS/2% BSA worden
toegevoegd en gedurende 1 uur bij kamertemperatuur geïncubeerd. Na 3 wassen met
25 PBS weid 100 ul oncogeen E6-detector (bijvoorbeeld MAGIl-MAGIl-IgG of GST-
MAGI1-PDZ1) bij 5 ug/ml toegevoegd in PBS/2% BSA en platen werden gedurende
45 minuten bij kamertemperatuur geïncubeerd. Platen werden vervolgens 3 keer ge-
wassen met PBS en geïncubeerd met anti-hlgG-HRP (Jackson Immuno Research) of
anti-GST-HRP (Pharmacia) bij de juiste concentratie in PBS/2% BSA gedurende 45
30 minuten bij kamertemperatuur. Na 5 wassen met 50 mM Tris/0,2% Tween-20 werden
platen geïncubeerd met 100 ul/putje van TMB-substraat (Dako Industries). De colori-
metrische reactie werd gestopt op juiste tijdstippen (gewoonlijk na 20 minuten) door
EU 1537 415 Bl
2.MAR.2009 16:31 NED. OCTROOIBUREAU 43703527580 NO.074 P.16
ACCOUNTS
130
toevoeging van 100 ul van 0,1 M H2SO4 en platen werden bij A450nm gelezen in een
ELISA plaat reader.
[0279] In een variant van de sandwich 1 ELISA werden cellysaten voor-geïncu-
beerd met oncogeen E6-detector bij 2,5-5 fig/ml uiteindelijke concentratie gedurende 1-
5 2 uur bij 4°C voorafgaand aan het toevoegen aan de met het anti-E6 antüichaam be-
klede plaat
[0280] Sandwicht type 2 ELISA: Bij sandwich 2 komen reagens en werkwijzen
overwegend overeen met die welke worden gebruikt bij sandwich 1. In tegenstelling tot
sandwich 1 wordt 100 ul van oncogeen E6-detector bekleed op de ELISA plaat en
10 wordt het anti-E6 antilichaam gebruikt voor detectie van oncogeen detector-gebonden
E6, gevolgd door anti-muis IgG-HRP (Jackson Immuno Research). Bij een gemodifi-
ceerde versie van sandwich 2 zullen gebiotinyleerde reagens (anti-E6 antilichaam of
oncogene detector) worden gebruikt gevolgd door streptavidine-HRP voor het verder
verlagen van de achtergrond en het verhogen van de gevoeligheid.
15
C) Resultaten:
[0281] Een sandwich ELISA werd in twee verschillende variaties ontworpen. Bij
Type 1 sandwich ELISA wordt een E6-eiwit dat aanwezig is in cellysaten gevangen
20 door E6-specifiek monoklonaal antilichaam en detectie van specifieke oncogene va-
rianten vindt plaats door middel van de oncogeen E6-PL detector. Bij de type 2 ELISA
opstelling wordt oncogeen E6-eiwit gevangen door middel van de oncogeen E6-PL
detector aan de vaste fase en detectie van E6 vindt plaats door middel van een specifiek
E6-antilichaam of een ander E6-bindend specifiek middel zoals nucleïhezuur-geba-
25 seerde bindende verbindingen, chemische middelen die E6 binden, E6-bindende eiwit-
ten of een combinatie van die verbindingen. Cellen werden direct gclyseerd op een
weefselkweekplaat en Jysaten werden vooraf geklaard door centrifugatie van onoplos-
bare bestanddelen. Lysaten werden vooraf geïncubeerd bij 4°C met oncogeen E6-PL
detector, een fusie-eiwit van GST en Magil PDZ-domein #1. Daaropvolgend werden
30 lysaten op met E6-specifieke antilichaam beklede ELISA-platen gebracht. Detectie
vond plaats door middel van toevoeging van HRP geconjugeerd GST-specifiek antili-
chaam en toevoeging van het HRP substraat TMB na de juiste wassen tussen de ver-
schillende incubatiestappen. Detectiesignaal wordt gevormd door een colorimetrische
EU 1537 415 Bl
2.MAR.2009 16=32 NED. OCTROOIBUREAU 43703527580 NO.074 P.17
ACCOUNTS
131
verandering die wordt gekwantificeerd door het gebruik van metingen van de absorptie
bij 450 nm.
[0282] Resultaten die zijn verkregen van een type 1 ELISA zijn getoond. HPV16-
E6 van getransfecteerde 293 EBNA-T-cellen die E6 tot overexpressie brengen en van
5 HPVl6-gemfecteerde baarmoederhalskanker afkomstige cellijnen werd gedetecteerd.
Voor HPV-geïnfecteerde cellen is de detectiegrens bij benadering 250.000 cellen (Fi-
guur 8). Het wordt voorspeld dat verlaging van de achtergrond, versterking van het de-
tectiesignaal en versterking van binding van E6:PDZ de gevoeligheid zal verhogen tot
25.000 cellen of minder. Verlaging van de achtergrond kan worden bereikt door het
10 optimaliseren van de keuze en concentraties van alle bestanddelen in het systeem als-
ook door aanvullende zuivering van bestanddelen of toevoeging van werkwijzen van
uitsluiting op grootte of filtratie. Detectiesignaal kan worden verhoogd door het gebruik
van meer gevoelige detectiesystemen, bijvoorbeeld luminescentie-gebaseerde technie-
ken. E6:PDZ binding kan bijvoorbeeld worden verhoogd door het modificeren van de
15 PDZ-basis van de oncogene E6-PL detector en door het behandelen van de E6-bevat-
tende lysaten met fosfatasen, waardoor aldus alle E6-PL-plaatsen worden vrij gemaakt
van elke fosfaat die met E6-P1-specifieke binding aan de oncogene E6-PL detector zou
kunnen interfereren, de binding zou kunnen verlagen of teniet zou kunnen doen.
20 VOORBEELD 12
ENDOGEEN E6-EIWTT VAN HPV-GEINFECTEERDE CERVICALE KANKER
CELLIJNEN KAN WORDEN GEDETECTEERD DOOR MIDDEL VAN EEN
MEMBRAAN-GEBONDEN ONCOGENE E6-PL DETECTOR. MEMBRAAN-
GEBASEERDE DETECTIE KAN WORDEN GEBRUIKT VOOR HET VERHOGEN
25 VAN DE GEVOELIGHEID VAN ONCOGENE E6-PL DETECTOR GEBASEERDE
TEST
A) Abstract:
30 [0283] Experimenten werden uitgevoerd om te tonen dat de ELISA testtypen 1 en
2 op baarmoederhalskanker kunnen worden uitgevoerd door het gebruik van een mem-
braan-gebaseerd formaat. Bij de membraan-gebaseerde vorm van de diagnostische kit
voor baarmoederhalskanker zijn de principes van de traditionele ELJJSA-gebaseerde
EU 1537 415 Bl
2.MAR.2009 16:32 NED. OCTROOIBUREAU 43703527580 NO.074 P.18
ACCOUNTS
132
sandwich 1 en 2 aangehouden, in het bijzonder met betrekking tot het vangen of het
detecteren van uitsluitend de oncogene vormen van E6. Het is gevonden dat de gevoe-
ligheid sterk is verhoogd in de membraan-gebaseerde test versus de traditionele ELISA.
5 B) Werkwijzen:
[0284] Blokkeer Coming platen met 12 putjes vooraf (weefselkweek behandeld
met deksel, polystyreen, putjes met een diameter van 22 mm) met 2 ml van PBS/2%
BSA en spoel vervolgens 3x met 2 ml PBS. Breng op een nitrocellulosemembraan 2 ul
10 van GST-Magil d 1 oplossing (88,6, 0,17 mg/ml) door het gebruik van een 2 ul pipet-
man (spots in duplo op een membraan van 1 x 1,5 cm, transblot, transfermedium, on-
dersteund nitrocellulosemembraan, catalogusnummer 162-0097 (0,2 uM), partij-num-
mer 8934). Laat ze gedurende 5-10 minuten aan de lucht drogen.
[0285] Hydrateer het membraan met 1 ml PBS gedurende een paar minuten in een
15 plaat.
[0286] Blokkeer het membraan in elk putje met 1 ml PBS/2% BSA gedurende 30
minuten bij kamertemperatuur onder schudden.
[0287] Was 3x met PBS -5-10 minuten/was, 1 ml/was, zuig de eerste was direct
af. Het is goed om bij kamertemperatuur te wassen.
20 [0288] Incubeer het membraan met cellysaat, -300 ul, 3 miljoen cellen in totaal,
gedurende 30 minuten bij kamertemperatuur (schud de oplossingen). Voer ook 1:10
verdunningen uit (3 miljoen, 300K, 30K, 3K) in PBS/2% BSA (33,33 ul monster, 300
ul PBS/2% BSA).
[0289] Was 3x met PBS, 3-57was, alle bij 4°C, 1 ml/was.
25 [0290] Incubeer het membraan met anti-E6 (6F4) gedurende 30 minuten bij 4°C
(1:5000 verdunning of 1:50 van 1:100 6F4 in PBS/2% BSA). (Nodig 0,4 ml/putje, en
voor 36 putjes is 16 ml nodig) 320 ul van 1:100 6F4,15,68 ml PBS/2% BSA.
[0291] Was 3x met PBS, 4°C, -5-10 minuten/was.
[0292] incubeer met HRP-anti-muis (1:1000) gedurende 30 minuten bij 4CC onder
30 schudden (HRP-anti-muis Ig mierikswortelperoxidase gekoppeld geheel antilichaam
van schaap, Amersham, NA93 IV, partij 213295. Gebruik 400 nl per putje. Voor 36
putjes zou men a) 16 ul HRP-anti-muis, 16 ml PBS/2% BSA nodig hebben.
EU 1 537 415 Bl
2.MAR.2009 16:33 NED. OCTROOIBUREAU 43703527580 NO.074 P.19
ACCOUNTS
133
[0293] Was 5x met PBS bij 4°C, -5-10 minuten schudden/wassen, laatste was 10
minuten. Zuig vervolgens de laatste was af en voeg 1 ml vers PBS toe aan elk putje,
[0294] Ontwikkel met ECL+ systeem in petriplaat en stel bloot aan Kodak film.
5 C) Resultaten:
[0295] Bij een sandwich type 2 opstelling werd GST-MAGIl oncogene E6-PL
detector op een membraan gebracht en afnemende hoeveelheden van HPVll en
HPV16 MBP-E6 fusie-eiwitten werden toegevoegd om te binden. Detectie met E6-spe-
10 cifieke antilichamen toonde duidelijk specificiteit van signaal voor oncogeen (HPV16)
maar niet voor niet-oncogeen E6 (HPV11). Bij langere blootstelling (5 minuten) waren
hoeveelheden van HPV16 MBP-E6 van 0,1 nanogram in totaal eenvoudig detecteerbaar
(Figuur 9 bovenaan).
[0296] Bij hetzelfde experiment werden lysaten van HPV16-E6 getransfecteerde
15 cellen en nagebootste getransfecteerde cellen toegevoegd aan een membraan-geba-
seerde S2-test. E6-specifiek signaal werd alleen verkregen voor de cellen die E6 tot
expressie brengen, niet voor de nagebootste getransfecteerde cellen (Figuur 9 onder-
aan). Deze resultaten tonen duidelijk dat de membraan-gebaseerde test op baarmoeder-
halskanker kan worden uitgevoerd in een membraan-gebaseerde vorm.
20 [0297] Bij een daaropvolgend experiment werden lysaten van HPV-geïhfecteerde
cellen getest (Figuur 10). Alleen de cellen die E6 van HPV16 tot expressie brengen
leveren signaal (SiHa en CasKi), maar niet de HPV-negatieve maar baarmoederhals-
kanker positieve cellijn C33. E6-specifiek signaal wordt verkregen bij 300.000 cellen,
dat aangeeft dat een geoptimaliseerde vorm van deze test HPV-E6 eiwitten kan detecte-
25 ren van aanzienlijk lagere celaantallen.
VOORBEELD13
DETECTIE VAN HPV16 E6 ONCO-PROTEINE IN EEN CERVTrATF. PARrr-
NOOM TUMOR
30
[0298] Een klein deel van weefsel werd verwijderd van een OCT ingebedde tumor
en in twee delen verdeeld. Eén hoeveelheid werd gebruikt voor RT-PCR gebaseerde
HPV typering, de tweede hoeveelheid werd gebruikt voor eiwitextractie.
EU 1537 415 Bl
2.MAR.2009 16=33
NED. OCTROOIBUREAU
ACCOUNTS li
43703527580
NO.074
P. 20
15
134
[0299] Voor het typere: i werd RNA geëxtraheerd door het gebruik van de TRIZOL
kit (Invitrogen). In het kort werd een klein weefseldeel overgebracht in 1 ml van
TRIZOL oplossing en de cellen werden geresuspendeerd en gelyseerd door het gebruik
van een Dounce homogenisator. RNA werd geëxtraheerd en geprecipiteerd met 2-pro-
5 panol en gekwantificeerd dlor de extinctie van 260 nm licht. 1 Microgram RNA werd
gebruikt voor het genereren van cDNA. Primers waren willekeurige hexameren, Super-
script ÏÏ (Invitrogen) werd gebruikt voor omgekeerde transcriptie. Primers die specifiek
zijn voor het E6-gen van HPV16, HPV18 en HPV45 werden gebruikt voor PCR op het
cDNA-matrijs en een band met de verwachte grootte werd verkregen voor primers die
10 specifiek zijn voor E6 van HPV 16 maar niet met primers die specifiek zijn voor
HPV18 of 45. De onderzochte tumor bestaat aldus uit met HPV16-geïnfecteerde cellen.
[0300] Voor eiwitextractie werd een weefseldeel direct gelyseerd in 1 ml lysisbuf-
fer ((50 mM Hepes pH 7,5/150 mM NaCl/1 mM EDTA/10% Glycerol/1% Triton/10
mM natriumflouride/1 mM natrium-orthovanadaat/1 mM PMSF/Calbiochem protease
remmer 1 : 100) en membranen werden gebroken door het gebruik van een Dounce
homogenisator van 3 ml. Tjotale eiwitconcentraties werden bepaald door de Bradford
eiwitconcentratietest en hoeveelheden die overeenkomen met -1.000.000 cellen werden
- jels. Lysaat van een niet-HPV16-gemfecteerde tumor werd
opgebracht als een negatieve controle.
20 [0301] Gels werden geanalyseerd door Western techniek door het gebruik van een
anti-HPV16-E6 specifiek rionoklonaal antilichaam. Een band van de juiste grootte
voor het HPVl6-E6-eiwit werd onthuld voor het lysaat dat afkomstig was van de
HPV16-geïnfecteerde tumor maar niet voor lysaten die afkomstig zijn van de HPV16
negatieve controle tumoren. De intensiteit van de banden was vergelijkbaar met de E6-
25 specifieke band die werd gedetecteerd met 1.000.000 HPV16-specifieke SiHa-cellen.
C33 - cervicale cellijn die ]jïPV E6-negatief is; MBP-E6 - een maltose bindend eiwit-
HPV16 E6 fiisie-eiwit; HPV E6 overexpressie - lysaat van HEK293 cellen die zijn ge-
transformeerd met een construct dat HPV16 E6-eiwit met de volledige lengte tot ex-
pressie brengt. Deze resultaten zijn getoond in Figuur IL
30
gescheiden op 12% PAGE-
EU 1537 415 Bl
2.MAR.2009 16:34 NED. OCTROOIBUREAU 43703527580 NO.074 P.21
ACCOUNTS
135
VOORBEELD 14
DETECTIE VAN BAARMOEDERHALSKANKER VAN HUMANE MONSTERS
DOOR HET GEBRUIK VAN SNELLE IMMUUNTEST TECHNOLOGIE EN
FLUORESCENTIE DETECTEE
5
A) Abstract:
[0302] Experimenten zijn beschreven waarbij de oncogene E6-PL detector is ge-
bruikt voor het op selectieve wijze detecteren van de aanwezigheid van oncogene E6-
10 eiwitten in humane monsters door het gebruik van een snelle immuuntest ("Rapid Im-
munoassay"; RIA) met het doel van diagnose van baarmoederhalskanker.
B) Werkwijzen:
15 [0303] Cervicale cellen zijn verzameld door het gebruik van een standaard cervi-
cale schraper of borstel zoals de CULTURETTE DIRECT (Becton Dickinson) en gere-
suspendeerd in een monster verdunningsmiddel. Cellen zijn verzameld door centrifu-
gatie en pellets werden geresuspendeerd in 200 ul koude lysisbuffer (50 mM Hepes pH
7,5/150 mM NaCl/1 mM EDTA/10% glycerol/1 % Triton/10 mM natrium-fluoride/1
20 mM natrium-orthovanadaat/1 mM PMSF/Calbiochem protease remmer 1 : 100), naar
5°C gekoeld en kort op de vortex behandeld om lysis te bewerkstelligen. Monsters
kunnen op dit punt worden overgedragen. 75 ul van het lysaat wordt verdund in
PBS/2% BSA en 150 ul (of de helft van het volume) wordt vervolgens toegevoegd aan
platen die geschikt zijn voor een fluorescentie reader die zijn bekleed met recombinant
25 MAGI1 domein 2 (waar naar hierin wordt verwezen als MAGI1 domein 2 maar in de
meeste publieke literatuur is herbenoemd tot domein 1) fusie-eiwit bij 5 ^ig/ml in PBS
en de niet-specifieke plaatsen werden geblokkeerd met dbumine of gelatine. Verdunde
cellysaten werden gedurende 30 minuten bij kamertemperatuur geïncubeerd. Na 3 was-
sen met PBS werd 100 ul FTTC gemerkt anti-oncogeen E6 antüichaam mengsel (dat
30 tezamen E6-eiwitten van alle algemene HPV soorten herkent) bij 0,5 ug/ml toegevoegd
in PBS/2% BSA en de platen werden 25 minuten bij kamertemperatuur geïncubeerd.
Platen zijn vervolgens 3 keer gewassen met PBS en fluorescentie is gemeten.
EU 1537 415 Bl
2.MAR.2009 16:34 NED. OCTROOIBUREAU 43703527580 NO.074 P.22
ACCOUNTS
136
C) Resultaten:
[0304] Diagnose van de fase van kanker wordt bepaald door middel van het
vergelijken van waarden van fluorescentie-intensiteit met standaarden en controles.
5
VOORBEELD 15
DETECTIE VAN BAARMOEDERHALSKANKER VAN HUMANE MONSTERS
DOOR HET GEBRUIK VAN SNELLE IMMUUNTEST TECHNOLOGIE IN EEN
TEST MET EEN STRIP MET LAMTNAIRE STROMING MET COLORI-
10 METRISCHE DETECTIE
A) Abstract:
[0305] Experimenten zijn beschreven waarbij de oncogene E6-PL detector is ge-
15 bruikt voor het op selectieve wijze detecteren van de aanwezigheid van oncogene E6-
eiwitten in humane monsters door het gebruik van een snelle immuuntest (RIA) in de
vorm van een dipstick (of de laminaire stroom vorm) met het doel van diagnose van
baarmoederhalskanker. Deze test is overeenkomstig aan de meeste hCG zwanger-
schapstesten van één-stap die thuis kunnen worden uitgevoerd.
20
B) Werkwijzen:
[0306] Cervicale cellen worden verzameld door het gebruik van een standaard
cervicale schraper of borstel zoals de CULTURETTE DIRECT (Becton Dickinson) en
25 geresuspendeerd in een monster verdunningsmiddel. Cellen zijn verzameld door centri-
fugatie en pellet werden geresuspendeerd in 200 ul koude lysisbuffer (50 mM Hepes
pH 7,5/150 mM NaCl/1 mM EDTA/10% glycerol/1% Triton/10 mM natrium-fluoride/1
mM natrium-orthovanadaat/1 mM PMSF/Calbiochem protease remmer 1 ; 100), naar
5°C gekoeld en kort op de vortex behandeld om lysis te bewerkstelligen. Monsters
30 kunnen op dit punt worden overgedragen. Lysaat wordt verdund in PBS/2% BSA naar
500 ul en toegevoegd aan de testinrichting. De testinrichting bevat een mengsel van
anti-E6 monoklonale antilichamen met gekleurd conjugaat en recombinant
MAGI1PDZ2 fusie-eiwit bekleed op een testgebied van het membraan. Door capillaire
EU 1 537 415 Bl
2.MAR.2009 16=35 NED. OCTROOIBUREAU 43703527580 NO.074 P.23
ACCOUNTS
137
werking migreert het monster van gelyseerde cellen over het testgebied en reageert met
de geïmpregneerde reagens voor het vormen van zichtbaar gekleurde banden in het
testvenster. De aanwezigheid van oncogeen E6-eiwit in het monster zal resulteren in de
vonning van een te onderscheiden gekleurde band in het testgebied dat aldus een posi-
5 tief resultaat aangeeft voor oncogeen E6-eiwit. Omgekeerd is indien geen lijn in het
testgebied verschijnt, de test negatief.
C) Resultaten:
10 [0307] Diagnose van kanker wordt bepaald door een vergeUjking tussen de kleur
van de testlijn in het testgebied en positieve en negatieve controles voor het bevestigen
van de juiste functie van de test.
[0308] De onderhavige uitvinding wordt in beschermingsomvang niet beperkt door
de geïllustreerde uitvoeringsvormen die als illustraties van enkele aspecten van de uit-
15 vinding zijn bedoeld en alle sequenties die functioneel gelijkwaardig zijn vallen binnen
de beschermingsomvang van de uitvinding.
EU 1 537 415 Bl
2.MAR.2009 16:35
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.074
P. 24
138
Tabel 9
Sfeqtt noma Slfeec dsntala
1 29*«u(nm!tp27 018438» 1
2 AFÖ 43ÖÖB3 1
a MPC 127S14S1 1
4 MPC 12761451 2
S AIP« ' tÏ7S14S1 3
e AlPC 12761451 4
7 H&msefänsi dcsodUtâUM prattin Z7730SÖ 1
8 /tf»xut 138B1283 1
e tntometing PmMn 2847231 1
10 Frdoractino PnäB&i 2667231 2
H AîropMo-1 ftitonotag PreMn 2S47231 a
U AftopNn-1 ? litwtacühöPwttófl 2B47231 4
n« IntBracörtgProï^r» 20O723Î 8
1* Atraprdn-1 294721 6
18 CAROtl 12362772 1
te CAROT4 1312SM23 1
17 CASK 3087018 1
tt Caftftadsr Entame 38Ö07» 1
te CytahïrtiBandînS PratfluA 3199988 1
20 DenönlBO 167SSB8Z 1
21 DLQ1 47BB16 1
22 CHüOI 475818 2
23 0U51 475810 3
2* nica ?0738852 1
25 0LÄ2 12736592 2
29 0LS2 12736552 3
27 0LG5 3850451 1
28 0105 36504B1 2
2S ÜLG8, spiJeavndint. 14647140 1
90 0LG8, spä» variant 2 ABDB33C3 4
91 OVt.1 2291005 1
32 ÖVL2 2201007 *
39 ovu 8808388 1
34 ' QJlMf »57144 1
35 ENIGMA S81O30 1
38 ERWN 6933608 1
37 Protein» 3220018 1
sa Pna&WS» 3220018 2
39 FUÓOQrfl 10440362 1
40 FU11215 11436389 t
41 FU1242» 8C012Û40 1
42 RJ12S15 10434208 t .
43 PU20Ö75 ^ 7D1W3B 1-
44 RJ218B7 10437838 1
45 RJ31348 AKQBWil 1
48 FÜ32708 AKosrsao 1
47 SRBM ?«536083 1
EU 1537 415 Bl
2.MAR.2009 16:35
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.074
P. 25
139
48 GRJP1 4S39893 2
4B 6RIP1 4938063 3
SO GftfM 4638083 4
St GRtPI 4fi39083 S

sz GRIP-! 4998083 8
53 ©?m 4638083 7
54 üTFe» Activating tnzynva 2398009 1
SS Quanta Eioctanga Ftctof 0850783 1
as M3tfBAiafi05OS 10438387 t
67 HBABA1Û006QS 10486367 2
SB HEMBA1003117 7022001 1
S9 HTBA3 AY0400B4 1
60 KIRAA AL57S444 1'
61 1NA0L 2370148 1
82 ÎNABL 2370148 2
63 [NADL 2370148 3
04 WADlL 237014ft 4
66 (NADU 2370149 5
6fi iNADL 2370146 6
67 INAÖL »70146 7
ea INASL 2370148 a
69 WAA0147 1408879 1
70 WAA0147 1468879 a
71 WAAÛ147 146807« a
72 MAA0147 1489875 4
"1» KMAÛ303 2224648
74 K1AAD313 78572BÖ
7Sr KiAAoaie 6883123
78 KMAÛ340 2224820
77 WAA0380 22Z47ÜD
78 WAAÖ382 7802087
79 tcvuouo 2882180
80 WAAÜ548 14782808
61 KWA0559 3043041
82 WAAOSB1 3043845
83 WAAC813 3327039
64 K1AA07S1 1273416S
as KIAAQ807 3882334
68 KIAA0859 4240204

87 KJAA09Q2 4240282
88 KIAA0967 4868877
89 KÎAAQ873 4888569
80 K1AA108B Shd952S
'81 KIAA1095 S889S20 2
W K4AAÎ20Z 6330421
93 «M12» 9330610
di KIAA12S4 633136»
SB KlAAtaaß 7243156
88 KMA141S 7243210
sr (ÖAA1S26 53171« S
SB KJAA152B 5617166 2
EU 1537 415 Bl
2.MAR.2009 16=36
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.074
P. 26
140
-89 KMA1S29 5917166 3
100 M3AA1620 10047316 1
101 WAA1634 10047344 1
102 K£AA1034 10047344 2
103 KtAAl694 1004734« 3
104 KUWM834 10047344 4
106 . KEAA1634 10047344 5
109 KWA1719 1267992 0
107 KIAA1719 1297892 1
108 KMA17TB 1297082 2
I«" K1M1719 1287682 3
no WAA1718 1297862 41
m «AA1719 1267682 5
112 ... MAA1719 1267062 6
113 UMMydfqu» 12734250 1
114 UMProtiEn 3108082 1
11S UMK1 4587490 1
116 UMK2 1905593 1
117 UM-AtL 1088021 1
118 LU-1 US2111 1
119 MA611 3370897 1
120 MAGM 3370997 2"
121 MAG« 3370897 ' 3
122 MAGJ1 3370697 4
123 MAGI1 3370997 6 ' ..........
» MAGH 3370997 e
125 KGC5385 BC012477 1
126 MWTt 2835024 1
1Z7 MIHT1 2828024 z
129 MINT3 3169800 i
129 MINTS 3169808 2
130 MPPI 169785 1
131 MPP2 839884 1
132 ttUPPI 2104784 1
133 MÜPP1 2104794 2
134 MUPP1 2104794 3
133 MOP« 2104794 4
136 MUPP1 2104794 5
137 MUPP1 210C7B4 e
130 MUPPl 2104704 7
139 MÜPP1 2104794 9
140 MUPPl 210478« 9
141 MUPPl 2104784 10
142 «IUPP1 21047B4 11
143 MUPPl 2104784 12
144 MUPP1 2104784 13
145 IWDLÛ 10983020 1
148 NeDLQ 10683820 2
147 NtDLQ 10863920 3
149 Mfturattnll AJ401189 1
EU 1537 415 Bl
2.MAR.2009 16=36
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.074
P. 27
141
140 NOS1 642525 1 î>6 PSDBfi 3316952 1
189 mwaJPOZgen» 7228177 1 ito PSD99 3316692 2
151 novel PDZ gan* 7229177 2 in PSD» 3316852 3
152 NuveJSflrtna Protäoää 1621243 1 176 PTOsî 179912 '1
183 Nano Bflrafing Prettin AK058823 . 179 FH*4 190747 1
154 Protein AK0S68Z» .ï ' ira PTPI1 513030 1
188 Numb B&Kfôio Pratarift AKD56823 3 181 PfPU 516030 2
169 NumbOfrtnQ Pnrttin AK056823 4 182 PTPL1 515090 3
167 Ou&sr.Memteww 7023825 1 183 PTPL1 615030 4
168 pssr 12733387 1 164 PTPM 515030 5
159 PARS ~8037814 ' 1 m RGS12 3290919 1
160 PAR3 8037814 2 189 RGS3 18944738 1
161 PAR3 9037814 "3...... 187 RhepftBitHH» 14279108 1
182 PAT» 2813011 . 4 188 SttfeB PWtt»*» 2738914 1
.183 PAR6 GAMMA 13537118 1 188 Sta*1 0049193 1
164 PD&73 6031979 1 180 Startes 1
IBB FD&73 5031878 2 191 Stoooro 18952939 1
168 PDZ-73 5031979 3 192 38*1 2047327 1
1S7 PÖZX1 2944189 1 183 SUM 2047327 2
168 PQZK1 20*4188 2 194 SJTRC-18 8888071 1
169 PDZK1 2944169 3 186 sn-Aciê 6899071 2
170 püzxi 2944199 4 199 SSIRIP 7Q2S4EG 1
171 PICK1 4676411 1 197 SYNTENJN 2785662 1
172 PIST 98374330 1 198 5YNTENJN ? 2706962 2
173 prtt.16 1479492 1 199 Syntragsitin 1 tiphs 1145727 1
174 prttJ» 1479492 2 200 %ntropWnt*tB2 479700 1
EU 1537 415 Bl
2.MAR.2009 16:37
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.074
P. 28
142
201 syntrephaiotmima 1 9507*62 1
202 SyntrapMn ojBmmB 2 8607164 1
203 TAXMlkBprotHlt) 3253116 1
204 T1AM1 4507800 1
205 TIAM2 6912703 1
209 TTP1 2813001 1
"i07 T1P2 2013003 1
208 T1P33 2918007 1
209 T1P43 2913011 1
210 X-Ubsla 3005559 1
211 X»11bate 380SS99 2
212 ZO-1 292037 1
213 Z<V1 292937 2 ?
214 ZO-1 282937 3
216 zoa 12734783 1
218 zo-2 12734763 2
217 Z03 12734763 3
219 ZO* 10092680 1
219 Z03 . 10092660 2
220 ZCS) 100B26SO 3
221 HPV4-E6
222 MPV11«5
223' HPV 20-66
224 HPV24.E8
225 MPV29-ËB
228 HPV36-EB
227 KPV48-Ë6
228 HPV 604=8
228 HPV16-E8
230 KPV16-E9
231 HPV 31-65
232 HPV35-EB
233 HPV3&EB
234 HPV 3943
235 HPV45-S
238 HPVS1-E8
237 HPV 52-69
aaa HPV8W58
239 HPVB9-68
240 HPVB8-EÖ
241 HPV 33*8
242 HPV «8*9
243 HPVeS-ÊB
244 HPV 694=8
246 HPV 28
248 HPV 53
247 HPV 69
249 HPV 73
249 HPV 82
250 2648(1054EF)
251 2549(1058ER)
2S2 2542{tOS0ËF)
283 2643 {1051 ER)
254 26B3(1071EF>
255 2594(1072ERJ
259 2565{1073E1VU
267 2SS9{1074&)
259 2661(10765«)
2S9 2662(1076gRPL)
2SQ 28O30O8OEF)
281 2a04(10S1ER)
292 2B05(10B2EHPL)
233 2808(1063EF)
384 2607<1084eR*
285 2609(108SERPD
zee 2Ö12C1088EF)
287 2313 (1087IÈR)
268 2314{1<IB8£RPL)
268 2619{106BEF}
270 2816(1O30ERJ
271 2B17(1091ERR.)
272 GST
273 1928 («MOLI 2F) ?
274 1929C885DL1 2R)
375 1453(43ßQÄF)
279 t«54(438BAR)
277 399f66TAF}
EU 1537 415 Bl
2.MAR.2009 16=37
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.074
P. 29
143
278 400{B7TAR)
299 131« (TIP 65-1)
280 r 1320{TO>G3-1)
231 2753 (ÎIOOTIF)
282 27620117TTA)
2» 2564(fOeOTIF)
r~Z84 asuödWiTiR)
285 2869{1083mR) ---------
286 25B7(1083TIF)
287 0L©1vPDZd2of3
286 MAGH.POZtf of 8
289 HP1
289 T1P1-FLH9GEX
291 TIPt-M&i
292 TIPKSMSg ?
283 Maßf1Ö2v2
294 M»sriÜ2v3
2BS StagtlQ3v4
m fi*^H02v&
29 M3tf102ve
29« Magl1D2\tf
289 Mttgl1D2v8
300 M*c/1D2v8
301 MsgllD2v10
302 MU0I1D2V11
3Û3 MosJ1D2vi2
304 M8BHB2V13
3« Magi102VT4
309 î/tegJ1D2v16 r~??
307 ütegHBZvre
SB M*Bt!027l7
309 MsgHO&rre
310 Msg1102«19 i
311 MegflOftSO
312 MsoHDZvSI
313. M301IKV»
314 MBBI1Q2V23
316 B4^J51D2«24
319 (VfegjflDStfS
317 l^1D2v29
318 Mftgl1D2v27
319 MagHD2v28
339 Mq8>1D2v29
321 M8BJ10BV3Ö
322 MagllD2vS1
323 Mflg!102*32
324 Msgj1ß2v33
328 »atflD2v34
32« MsgW&VSS
327 6togHD2v36
328 JWaBti02y37
328 Ma§J102v38
330 M»fjt1D2v3B
EU 1537 415 Bl
2.MAR.2009 16=38 NED. OCTROOIBUREAU 43703527580 NO.074 P.30
ACCOUNTS
144
SEQUENTIFTTTST
[0309]
<110> lu, Peters.
Scnweizer. Johannes
OkTz-SsnTtienla, Chamarra Somoza
Beirnares, Mtehaeî P.
<12Q> WETOODS OF DEAGNÖSING CERVICAL CANCER
<1SQ>VrTA-008WO
<15D> 6W409.298
<151>20O2-Q9-09
<15Q> 60/450,464
<1S1>20ö3-02-27
<150> 10/630.590
<151>2G83-07-2S
<15D> SOMSO,094
<151> 2003-07-25
<160> 330
<17D> FSBtSEQ tor Windows Version 4.0
<210> 1
<211> 87
<2t2> PST
<313> Homo sapiens
<4D0t» 1
Arg Asp Met, Ala Glu Al« Hia Ly» Gla Ala Met Sex Ar« Lys tea Gly
X S . 10 15
Gib Ser Glu Sf r Sin Gly Fro Pro Arg Ala s ba Ala Lya val Aon Sar
20 25 30
zla 9«« Fro Gly Ser Pro Ser Xle Ala Gly Leo Gin val Asp Asp Glu
39 40 45
XI« Val Glu She Gly Ser- viol Aaa Thr Gin Ash Ph» Gin Box Leu His
50 SS «0
Asn 11» Gly Ser Val Vol Gift ai« Sec Glu Gly Ala Leu Ala Pr» Sh*
65 70 7S 80
Xle Lou Leu Ser Val ser Met
55
<210>2
«311>9ô
<212>PRT
<213> Hans» sapiens
<40O>2
EU 1537 415 Bl
2.MAR.2009 16:42 NED. OCTROOIBUREAU 43703527580 NO.075 P. 2"
ACCOUNTS
145
Lau Xxç Lys Glu Pro Glu Ha Ils Thr Val Thr Lee Lya Lye .Gin Aan
1 , 5 10 15
Gly Hst Gly Leu Ser Ile Val Ala Ala Lya cly Ala Gly Gin Aap Lya
20 25 30
Leu Gly Ue Tyr Val Lye Sa* Vsl Val Lys Gly Gly Ala Ala Asp Val
.33 40 4S
Aap Gly Ar? lau Ale Ale Gly Asp Gla Leu Lee Ser Val Asp Gly Acg
50 SS «Q
Ser Leo V»l Gly Leo Sur Gin Glu Ar? Ala Ale Glu Leu Met Thr Arg
6S 70 75 tO
Thr 8er Sw val val ;hx Leu Glu V31 Ala Lys -Gin Gly
65 90
<210>3
<211> 105
<212>PRT
<21S> Homo sapiens
<c4Q0>3
Leu Xle Arg Pro Ser Val Ile 3er Xle Xle Gly Lau Tyr Lye Glu Lye
15 10 15
Gly Lys Gly Leu Gly Phe Ser Uo AI« Gly Gly Arg Asp eye Xle Aro
20 2S 30
Gly Gin Met Gly Xle Phe Val Lye fhr Xl« Phe Pro Asn Gly 3er Ala
35 40 «5
Ala Glu Afip Sly Arg Lau Ly« Glu Gly Asp Glu Xle Leu Aep Val Aon
SD 55 60
Gly IIb Pro Ile Lys Gly Leu Thr Phe Gin Glu Ala Xle Hls Th» Phe
55 70 75 80
Lya Gla Xle Arg Ser Gly Leu 'Pfta Val Lau Thr V«l Arg Thr Lye Leu
95 90 95
Val Sar Pre Ser Lou Thr Aan Ser Sar
IOO 105
<210>4
<211>132
<212>PRT
<213> Homo sapiens
«*40D>4
EU 1537 415 Bl
2.MAR.2009 16:42 NED. OCTROOIBUREAU 43703527580 NO.075 " "" ' P.3"
ACCOUNTS
146
Gly lie ser Ser Leu Gly Arg Lye Ihr Pro Gly Pro Lys Asp Ar? Ue
l 5 10 is
Val »et Glu val Thr Leu Aan Lye Glu Pro Arg Val Gly Lou Gly Xle
20 25 30
Gly AL» Cye Cye Leu Ala Leu Glu Asn Ser Pro five Gly lia Tyr Xla
3S 40 45
Bis Sax Leu Ale Pre» Gly ser Val Al* Lye Mat Glu See Aen Lao See
50 55 50
Arg Gly Asp Glu Ile Leu Glu val Asn ser vâl Asn Vel Arg His Ala
65 70 75 00
Ala Leu Ser Lys Val Bis Ala XI» leu Ser Lya Cye fro Pro Gly Pro
«S so 95
Val Arg Leu Val He Gly Arg His Pre Asa Pro Lya Val Ser Glu Gin
100 105 110
Glu Ret Asp Glu Vol Ha Ala Arg Ser Thr Tyr Gin Glu Ser Lye Glu
115 120 125
Ale Aan Sar Sar
ISO
<21D>5
<211>105
<212>PRT
<213> Homo sapiens
<40B>5
Gin Ser Glu Aen Glu Glu Asp Val Cya Phe Xle Val Leu Asn Arg Lye
t 5 10 " 15
Glu Gly Ser Gly Leu Gly Phe Set Val Ala Gly Gly Thr Aep val Glu
20 29 30
Pro Lya Ser Xle Thr Val Hio Arg val Phe Ser Gin Gly Ala Ala Ser
35 «0 45
Gift Glu Gly The Met Ae» Arg Gly Asp Phe Leu Lau Ser Vavl Aen Gly
So 55 50
Ala Ser Luu Ala Gly Leu Ale ale Gly Aan Val Leu t»ys Val Lau KIe
55 70 75 80
Gin Ala Gl» Leu Ble Lye Asp Ale Leu Val Vel Xle Lye Lye Cly «et
es $o ss
Aap Gin Pro Arg Pro Sex Aen Sar Ser
100 105
<210>6
<211>101
<212>PRT
<213> Homo sapiens
<400>6
EU 1537 415 Bl
2.MAR.2009 16:42 NED. OCTROOIBUREAU 43703527580 NO.075" " "P.4
ACCOUNTS
147
Leu Gly Arg Ser Vol Ale Vel Sla Aap Als Leu cya Val Glu Vel Leu
IS 10 15
Lye Thr Sor Ala Gly Leu Gly Leo 5er Leu Asp Gly Gly Lye Ser Ser
20 25 30
Val Thr Gly Aap Gly Pro Leu Val XI« Lya Arg Val Tyr Lya Cly Gly
35 «O 45
AI« Ale Glu Gin Ale Gly IIa Xle Glu Ala Qly Aap Glu Xl« Leu Ala
50 55 60
Xle Asn Gly Lya Pro Lau Val Gly Leu Met Hie Phe Aap Ala Trp Aen
6S 70 75 OO
Xle Hat J,ya Sar Val Pro Glu Gly Pro Val Gin Lau Lau Xla Arg Lys
BS SO 95
Sis Arg Asn Sex Ser
100
<2HJ>7
<211>74
<212>PRT
<213* Homo sapiens
<40O>7
Gin Thr Val Xle Lau Pro Gly Pro Ala Ala Trp Gly Phe Arg tma S«r
15 10 25
Ely Gly Xle Aap Phe Asn Gin Pro,Leu Val Xle Ihr Arg Xla Thr Pro
20 25 SO
Gly Sar Lys Ala Ala Ala Ale Asn Leu Cye Pr» Gly Asp Val Xla Leu
35 «0 «5
Ala Xla Aap Gly Phe Gly Thr Glu Sex Met Thr Hia Ale Asp Gly Gin
50 55 60
Aap Arg Xle Lya Ala Ale Glu Phe Xle Val
65 70
<2no>8
<211>85
<212> PRT
<2i3> Homo sapfens
<â00>8
XI« Leu Val Glu Val Gin tou Ser Gly Gly Ale Pro Trp Gly Phe TAX
15 10 15
Leu Lye Gly Gly Arg Glu aie Gly Glu Pro Leu Vel Xle Thr Lye Xle
20 25 30
Glu Glu Gly Ser Lys Ala Ale Ala Val Aap Lya Leu Lau Ale Gly Aep
3S «Q «5
Glii Xla Val Gly Xle Aen Asp Xla Gly Leu Ger Gly Pha Arg Gin Glu
50 SS 60
Ala Xle Cys Loa Val Lyn Gly Ser Bis Lys Thr Leo Lys Leu Val Val
65 70 75 80
Lye Arg Aan Ser Sax
es
EU 1537 415 Bl
2.MAR.2009 16:43 NED. OCTROOIBUREAU 43703527580 NO.075- P.5'
ACCOUNTS
14g
<210>9
<211>104
<212> PRT
<213> Homo sapiens
<4Q0>9
Arg Glu Lys Pro Leu Pha Thr Arg Aap Ala Ser Gin Leu Lys Gly Thr
?1 S 10 IS
Phe Leu ser Thx ihr Leo Lys Lys Sar Aen Met Gly Pha Gly Pho Thr
20 25 30
Xle Xle Gly Gly Aap Glu pro Aap Glu Pha Lau Gin Val Lys Sar Vel
35 40 45
Xle Pro Aep Gly Pro Ale Ala Gin Aap Gly Lye Met Glu Thr Gly Aap
SO SS ?0
Val Xle Val Tyr Xle Asn Glu Val Cye Val Leu Gly Bie Thr Bis Ale
65 70 75 SO
Asp Val Val Lye Leu Phe Gin Ser val Pro Xle Gly Gin Ser Val Asn
85 90 95
Leu Val Lau Cye Arg Gly Tyr Pro
100
<210>10
<211?31
<212> PRT
<2i3> Homo sapiens
<i#30>10
Leu Sw Gly Ala Thr Gin Ala Glu Lau Met Thr Leu Thr Xla Val Lys
IS 10 IS
Gly Ala Sin Gly Phe Gly Phe Thr Xle Ala Aap Ser Pro Thr Gly Gin
20 ' 25 30
Arg Val Lya Gin Xle Leu Aap Xle Gin Gly Cys Pro Gly Leu Cya Glu
35 40 45
Gly Aap beu Xle Val Glu Xle Asn Gin Gin Aan Val Gla Aen Lau Sac
50 55 ?0
Bis Thr Glu val val .Asp Xle Leu Lys Asp Cys Pro Xle Gly Sex Glu
65 70 75 00
Thr Ser Leu xle Xle Hie Arg Gly Gly Phe Pho
BS 90
<t10>11
<211>93
<212s-PRT
<213> Homo salens
<^C0>11
Six Tyr Lys Glu Leu Asp Vol Bis Leu Arg Arg Met Glu Ser Gly Phe
1 S 10 15
EU 1 537 415 Bl
2.MAR.2009 16:43 NED. OCTROOIBUREAU 43703527580 NO.075 "P.6"
ACCOUNTS
149
Gly Phe Arg Xle Leu <31y Gly Asp Glu Pro Gly Gin Pro Xle Leu Xle
20 25 30
Gly Ala Vel Xle Ale Met Gly Ser Ale Asp Arg Asp Cly Arg Leu Sie
35 40 «5
pro Gly Aap Glu Leu Val Tyr Vel Asp Gly Xle Pro Val AI« Gly X»yo
50 SS 60
Thr Kis Arg Tyr Vel Xle Asp Leu Mçt Bis Hie Ale Ala Arg Asn Gly
SS 70 '75 80
Sin Vel Aea Lau Tbr Vel Aro; Arg Lys Val Leu Cys Gly
85 »0
<21ß>12
«211> JOS
«212>PKT
<213> Homo sapiens
<40D>12
Glu Gly Arg ©ly Ile Ser Ser Qie Ser Leu Sin Thr Ser Aep Ale Val
1 ? S 10 15
Xle Bis Arg Lys Glu Asn Glu Gly Phe Gly Pho Val xla Xle Ser Gor
20 25 30
Leu Asn Arg Pro Gla Ser Gly ser Thr Xle Thr val Pxo His Lys IIa
35 40 43
Gly Arg Xle Xle Asp Gly Ser Pro Ale Asp Arg Cye Ale Lyve Leu Lys
50 55 «0
Val Gly Asp Arg Xle Lau Ala Val Asn Gly Gin 6er Xle Xla Aen Mat
65 70 75 30
Pro Sie Ala Asp Xle Val Lye i*u Ile lye Aap Ala Gly Lau sex Val
85 90 95
Thr Leu Arg £le Xle Pro Gin Glu Glu Leu
100 105
<210>13
<211>95
<212> PRT
<213> Homo sapiens
«4Q8>13
Leu Ser Asp Tyr Arg Gl» Pro Gin Aap Phe Aap Tyr Phe Thr Vel Asp
IS 10 IS
Met Glu Lye Gly Ale Lys Gly Phe Gly Phe Ser Xle Arg Gly Gly Arg
20 25 30
Glu Tyr Lye Met Aep Leu Tyr Val. Leu Arg Leu Ala Glu Asp Gly Pro
35 40 45
Ale Xle Arg Aän Gly Arg Met Arg Vel Gly Aep Gin Xle Zle Glu lie
SO SS 60
Asn Gly Glu Ser Thr Arg Aap Met Thr Bia Ala Arg Ala Xle Glu Lau
65 70 75 BO
Xle Lys Ser Gly Gly Arg Arg Val Arg Lau Leu Leu Lya Arg Gly Thr
35 so 95
Gly Gin
EU 1537 415 Bl
2.MAR.2009 16:43 NED. OCTROOIBUREAU 43703527580 NO.075 P.7-
ACCOUNTS
150
<21QM4
<211>90
<212> PRT
<213> Storno sapiens
<4ö0> 14
als Glu Ser Val Xle Gly Arg Asn Pro Glu Gly Gin Leu Gly phe Glu
1 5 10 15
Leu Lye Gly Gly Ale Glu Asn Gly Gin Pha Pre Tyr Leu Gly Glu Val
20 , 25 30
Lyn Pro Gly Lye Val Ala Tyr'Glu Ser Gly Ser Lys Leu Val Ser Glu
35 48 45
Glu Leu Lau Leu Glu Val Asn Glu Thr Pro Val Ala Gly Leu Ter Xle
50 55 60
Arg Aap Val Laa Ale Val Xla Lys His Cy» Lys Aap Pg0 Leu Arg Lau
65 70 75 60
Lys eye Vol Lys Gin Gly Gly Xle Hie Arg
85 90
<21Û>15
<211>126
<212>PRT
<213> frtiHRO sapiens
Asn Leu nat Sh* Arg Lye Pha ser Leu Glu Arg Pro Pha Arg Pro Sar
15 10 15
Val Thr Sex Val Gly Sie Val Arg Gly Pro Gly pro Ser Val Gin Hie
20 25 30
Thr Thr Leu Asn Gly Aep Ser Leu Ihr Ser Gin Leu Thx Lau Leu Gly
35 40 45
Gly Aan Ale Arg Gly Ser Pha Val Ris Oer Val Lys Pro Gly 9er Leu
SO SS 60
AI« Glu Lye Ala Gly Leu Arg Glu Gly Bio Gin lÄm Leu Leu Leu Glu
65 70 75 SO
Gly Cye xle Arg Gly Glu Arg Gin Sar Vel Pro Leo Aap Thr Cys Thr
05 .SO ? 95
Lya Glu Glu Ala Sie Trp Thr Xlo Gin Arg Cye Ser Gly Pro Vel Thr
100 105 110
Lau als Tyr Ly« Val Asn Bis Glu Gly Tyr Arg Lya Leu Vel
113 120 12S
<2ia>i6
<211>100
<212?PRT
<213> Homo safSens
«üIOOMG
EU 1537 415 Bl
2.MAR.2009 16:44 NED. OCTROOIBUREAU 43703527580 NO.075 P.8
ACCOUNTS
151
Xle Leu Ser Gin val Thr Met Leu Ala Phe Gin Gly Aap Ala Leu Lau
1 S 10 IS
Glu Gin Xle Ser Val Xla Gly Gly Aen Leu Thr Gly Xle Pha Xla Ble
20 25 30
Arg Val Tbr Pro Gly Ser Ala Ala Asp Gin Mat Ala Leu Arg Pro Gly
35 40 45
Thr Gin Xl.e Val Met Val Asp Tyr Glu Ala Sac Glu Pro Leu Phe Lys
50 55 60
Ala Val Leu Gla Asp Thr Thr Leu Glu Glu Ala Val Gly Leu Leu Arg
6S 70 75 00
Arg Vel Aap Gly Phe Cye cya Leu Sex Val Lys Val Aan Thr Asp G&
'05 90 95
Tyr Lye Arg Lao
IOO
<210> 17
<211>90
<212>PKT
<2t3> Hon» sapiens
<aoo>17
The Arg Val Arg Leu Vel Gin Phe Gin Lys Aen Thr Asp Glu Pro Met
15 10 15
Gly Xle thr Leu Lys Met Asn Glu Leu Asn His Cye Xla Val Ala Atg
20 25' 30
Xle Met aie Gly Gly Met Ile Hie Arg Gin Gly Thr Leu Sis Val Gly
35 40 45
Aep Gltt Xle Arg Glu Xle Asn Gly Xle Sex Val Ale Asn Gin Thr Väl
£0 55 60
Glo Gin Leu Gin Lye Met Leu Arg Glu Met Arg QXy Ser Xle Thr Phe
65 70 . 75 80
Lys Xle Val Pro 5er Tyr Arg Thr Gla Sar
SS 90
<21C018
<211>88
<2T2> PRT
<213> Hon» sapiens
«J0O>T8
Leu Glu Gin Lya Ala Val Leu Glu Gin Val Gin Leu Asp Ser Pro Leu
1 5 10 13
Gly Leu Glu Xle Klar Thx Thr Sog asn eye' Gin Ria Pha Val S«r Gin
20 25 30
Val Aap Thr Gin Val Pro Thr Asp Sex Arg Leu Gin Xle Gin Pro Gly
35 40 45
Asp Gltt Val Val Gin Xle Asn Glu Gin val Val Val Gly Txp Pro Arg
50 SS 60
Lys Asn Met val Arg Glu Leu Leu Arg Glu Pro Ale Gly Leu Ser Leu
65 70 75 80
Val Leu tya Lya Xle Pxo Xla Pro
05
<210> 19
EU 1537 415 Bl
2.MAR.2009 16:44 NED. OCTROOIBUREAU 43703527580 NO.075 P.9
ACCOUNTS
152
<211>92
<212>PRT
<21S> Homo sapiens
cdOO>tâ
Gin Arg Lye Lau Val Thr Val Glu. Lys Gin Asp Aen Glu Thr Phe Gly
1 , 5 20 15
Phe Glu Xle Gin Ser Tyr Arg P*e .Gin Asn Gin Asn Ala Cys Ser Ser
20 2S 30
Glu Met Pha Thr Leu Xle Cya Lys Xle Gin Glu Aap Sor Pro Ala Bis
35 40 45
. Cys Ala sly Lou Gin Ala Gly Asp Val Leu Ala Aen Xle Asn Gly Val
50 SS 60
Ser Thr Glu Gly Pha Thr Tyr Lys Gin val Val Aap Leu Xle Arg ser
6S 70 75 «0
Ser Gly Asn Leu Lea Thr Xle Glu Thr Leu Asn Gly
85 90
<21Q>20
<211>10S
<212> PRT
<2t3> Hon» sapiens
<4O3*20
Arg Cys Leu Xle 01a Thx Lya Gly Gin Arg Ser Met Asp Gly Tyr Pre
15 10 15
Glu Gin Phe Cys V*l Arg Xle Glu Lye Asn Pro Gly Leu Gly Phe Ser
20 25 30
Xle Sor Gly Gly Xle Ser Gly Gin Gly Asn Pre Phe Lya Pro Ser Asp
35 40 45
Lye Gly Xle Phe Vel Thr Arg Vel Gin Pro Asp Gly Pro Ala Sax Asn
50 55 60
Leu Leu Gin Pre Gly Asp Lya Xle Leu Gin Ale Asn Gly Hia Ser Phe
65 70 75 80
val Sis Met Glu His Glu Lya Ala Val lau Leu Leu Lys Ser phe Gib
05 . 90 35
Aan Thr Val Aap Leu Val XI« Gin *cq Glu Leu Thx Val
100 105
<210>21
<21Î>101
«212> PRT
<2..3> Norms sapiens
<*00>21
EU 1 537 415 Bl
2.MAR.2009 16:44 NED. OCTROOIBUREAU 43703527580 NO.075 P.10
ACCOUNTS
153
Ile Gin Val Asn Gly Thr Aap Ala Aep Tyr Glu Tyr Gla Glu Xle Thr
1 S 10 » 15
Lau Glu Arg Gly Aen Sor Gly Leu Gly Phe Ser Xle Ala Gly Gly Thr
20 25 30
Asp Ase. Pro His Xla Gly Aep Asp Ser Sar Xle Pha Xla Thr Lye xle
35 40 45
Xle Thr Gly Gly Ala Ale Ala Gli» Asp Gly Arg Leu Arg Val Asn Aap
50 55 SO
Cya Xle Leu Gift Val Aaa Glu Val Asp Vel Arg Asp Val Thr Hia Ser
65 70 75 BO
Lys Ala Val Glu Ala Leu Lys Glu Ala Gly ser He Val Arg Leu Tyr
85 90 95
Val Lys Arg Arg Asn
100
<210>22
«21?>95
<212> PRT
<213> Homo sapiens
<4G0>22
Xle Gin Leu Xle Lya Gly Pro Lys Gly Leu Gly Phe Ser .lie Ala Gly
15 10 IS
Gly Val Gly Asn Gin Ria 11« pro Gly Asp Aan Sar Xle Tyr Val Tax
20 26 30
Lys Xle Xle Glu Gly Gly Ala Ala His Lye Asp Gly Lys Leu Gin Xle
36 40 45
Gly Asp Lys Leu Leu Ala Val 3\en Ash Val Cys Leu Glu Gin val Thr
50 95 GO
His Glu Glu Ala Val Thr Ale Leo Lye Aan Thr Ser Asp Phe Vel Tyr
65 70 75 80
Leu Lya Val Ale &y* Pro Thr ser Het Tyr Met Ash Aap Gly Asn
85 90 95
<210>23
<211>S5
<Z12> PRT
<213> Homo sapiens
<*00>2S
lie Leu Äiö Arg Gly ses Thr Gly I«« öiy «* Aen Ile Val Gly «Gly
1 s 10 IS
Glu Aep Gly Glu Gly île Phe IIa Sar ehe Ile Leu Ala Gly Gly Pro
25 30
Ala Aap L«* Sex Gly Glu Lau Arg Lya Gly Asp Arg Ile Ile Ser Val
38 40 45
Asn Ser Val Aep Leu Axg Ala Ala Ser «is Giu Gin Ale Ala Ale Ale
Leu Lya Aen Ala Gly Sin Ala Val Thr Xle Vhl AI« Gin Tyr Arg Pro
70 75 an
Glu Glu Tyr fier Arg 9Q
05
<210>24
EU 1 537 415 Bl
2.MAR.2009 16:45
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.075
P.11
154
<211*101
<212>PRT
<2I3> Homo sapiens
<40a>24
Xle Sex Tyr
1
Thr Leu Glu
Thr Asp AS&
35
Xle Ile Pro
50
Asp Cya XI«
65
ser Lys Ala
Tyr Val Arg
Val Aan
5
Arg Gly
20
Pro Ois
Gly Gly
Leu Arg
Val Glu
85
Arg Arg
100
Gly Thr
Aen 8er
Xle Gly
Als Ala
55
Val Asn
70-
Ale Lau
Giu Ile Glu Tyr
10
Gly Leu Gly" Phe
25
Aep Asp Pro Gly
40
Ale Glu Asp Gly
Glu Val ASp Val
75
dys Glu Ale Gly
90
Glu Phe Glu Glu Xle
15
Ser lie Ala Gly Gly
30
Xla Phe Ile Thr Lya
4S
Arg fceu Arg Val Asn
60
Ser Glu Val Ser Ria
80
S«z Xla Val Arg Lau
95
<2t0>25
<2îT>34
<212>PRT
<21S> Homo sapiens
<400> 2o
Xle Ser Val val Glu Xle lya Leu Pho Lys Gly Pro Lye Gly Leu Gly
15 10 15
Phe Ser Xle Ale Gly Gly Val Gly Aen Gin Ria xle Pro Gly Aap Asn
20 25 30
Ser Xle 'Tyr Val Thr Lye Xlo Xla Asp Gly Gly Ala Ale Gin Lys Aep
35 40 45
Gly Arg Leu Gin vel Gly Asp Arg Leu Leu Met Val Asn Asn Tyr Ser
SO SS 60
Leu Glu Glu Val Thr Hie Glu Glu Ala Val Ala Xla Lau Lys Aen Thr
6S 70 75 60
Ser Glu val Val Tyr Leu Lya Vsl Gly Aon Pro Ti» Thr rie
SS 90
<210>2S
<211>S5
?c212>PRT
<2is> Homo saptens
<^K5>2S
EU 1537 415 Bl
2.MAR.2009 16=45 NED. OCTROOIBUREAU 43703527580 NO.075 P.12
ACCOUNTS
155
Xla Trp Ala Val Sex Leu Glu Gly Glu Pro Arg Lys Vel Val Leu Ois
15 10 15
Lya Gly Sex Thr Gly Leu Gly Phe Asn Xle Val Gly Gly Glu Asp Gly
20 25 30
. Qlu Gly Xle Pha Val Sar Pho Xla Lea Al3 Gly Gly Pro Ale Asp Leu
35 40 45
Ser Gly Glu Xeu Gin Arg Gly Aap Gin Xle Leu Ser Val Asn Gly IIa
SO 55 60
Aap Lee Arg Gly Ala.Ser Bis Glu Gm Ala Ale Ala Ala Leu Lys Gly
65 70 75 SO
Ala Gly Gin Thr Val Thx Xle Xla Ale Gin Tyx Gla Pro Glu Asp
85 90 95
<2H>27
<211>102
<2i2> PRT
<213> Homa salens
<400>2?
Gly Xle Pro Tyr Val Glu Glu Pro Arg His Val Lya val Gin Lye Gly
IS 10 '15
Ser Glu Pro Leu Gly Xle Ser Xle Val B*x Gly Glu Lys Gly Gly He
20 25 30
Tyr Val Ser Cye Val Thr Val Gly Ser Xle Ala Bis Gl» Ala Gly Leu
35 40 45
Glu Tyr Gly Asp Gin Leu Leo Glu Pha Aan Gly Xle Asn Leu Arg Sex
50 SS 60
Ala Thr Glu sin Gin Als Arg Leu Xle Xle Gly Ola Gin Cys Aap Thr
63 70 75 80
Ile Thr Xle Lau Ala Gin Tyr Aen Pro Bis Val Hia Gin Leu Arg Asn
05 90 95
See Sex Glx Le« Thr. Aep
100
<21J>2S
<211>103
<212>PRT
<213>Hom0'SapiK3s
<tm>2&
Gly xia Leu Ale Gly Asp Ale Asa Lys Lys Thx l»i Glu Pro Arg val
15 10 15
vel Pha Xle Lya Lya Ser Gin Leu Glu leu Gly Val Hie Leu Cys Gly
20 25 30
Gly Asn Lau Hia Gly val Pha Val Ala Glu Val Glu Asp Asp Sex Pro
' 35 «0 45
Ala Lys Gly Pro Asp Gly Leu Val Pro Gly Aap L«u Xle Leu Glu Tyr
SO SS 60
Gly Ser Leu Asp Val Arg Asn lys Thr Val Glu Glu Val Tyr Val Glu
«3 70 ?5 80
Met Leu Lys Pro Arg Asp Gly Val Arg Leu Lya Val Gin Tyr Arg Pro
85 90 95
Glu Glu Phe Xle Val Thx Asp
100
EU 1537 415 Bl
2.MAR.2009 16:45 NED. OCTROOIBUREAU 43703527580 NO.075 P.13
ACCOUNTS
156
«210>29
<211>141
<212> PRT
<213> Home ss^fens
<4G0>29
Pro Thr Ser Pro Glu Ile Gin Glu Lau Arg Gin Met Leu Gin Ala Pro
15 10 IS
Hie Phe Lye Ala Lau Leu sar Ale His Asp thr Xle. Ale Gin Lye Asp
20 25 30
Pha Giu Pro Leu Leu Pro Pro Leu Pro Asp asd Ile Pro Gin -Ser Glu
35 «0 45
Glu Ala Mat Arg Xle Val eye Lea Val Lys Aen Gin Gin Pro Leu Gly
50 55 60
Ale Thr Xla Lys Arg Sis Glu »at Thr Gly Aep lie Leu Val Ala Arg
6S 70 75 i 80
Xle lie His Gly Gly Leu Ala Glu Arg Sex Gly Leu Leu Tyr Ala Gly
83 90 95
Asp Lys Leu Val Glu Val Asn Gly Val Sex Vel Glu Gly Leu Asp Pro
1O0 105 110
Glu Gin val Xle ais Xla Lau Ala Met Ser Arg Gly Thr Xle Met Ph©
115 120 125
Lye Vol Val Pro Vel Ser Asp Pre Pro Val Asn Sax Sar
UO 135 140
«21O30
<211>97
<212> PRT
<213» Homo sapiens
<40Co3D
Pro Thr Ser Pro Glu Xle Gin Glu Leu Arg Gin Mat Leu Gin Ala Pro
IS 10 15
Hie Phe Lye Gly Ala Thr Xle Lye Arg Hie Glu Met Thr Gly Asp xle
20 25 30
Leu Val Ala Arg Xle lie His Gly Gly Leu Ala Glu Arg Ser Gly Lau
35 40 45
Lau Tyr Ale Gly Asp Lys Leu Val Glu Val Asa Gly Val Sar Val Glu
50 55 60
Gly Leu Aap pro Glu Gin Val Xle Hia Xle Leu Ala Met Sex Axg Gly
65 70 75 80
Thr Xla Met Pho Lye Val Vsl Pro Val Sex Aep Pro Pro Val Asn -Ser
95 90 SS
sex
<210> 3Î
<aii>93
?312>PRT
<2l3> Homo sapiens
<4Q0>3Î
EU 1537 415 Bl
2.MAR.2009 16=46 NED. OCTROOIBUREAU 43703527580 NO.075 P. 14"
ACCOUNTS
157
Leu Asa Ile val Thr val Thr Leu Asn Met Glu Arg Hie Sie Phe Leu
15 10 IS
Gly Xla Ser Xle Val Gly Gin Ser Asn Asp Arg Gly Asp Gly Gly Xle
20 25 30
Tyr Xle Gly Ser Xle Met Lyo Gly Gly Ala Vel Ale Al« Asp Gly Arg
35 40 45
Xle Glu Pro Gly Asp Met Lau Leu ein Vel Asa Asp Val Asn Phe Glu
SO 55 60
Ann Met Ser Asn Asp Asp Ala Val Arg Val Leo Arg Glu Ile Vel Ser
65 70 75 60
Gin Thr Gly Pro Ue Ser Leu Thr Val Ala Lya Cye Trp
85 90
<210s>32
«211*100
<212>PRT
<213> Homo saptens
Ǥao>32
Leu Aon Xle Xla Thr Val Thr Leu Asa Met Glu lye Tyr Aan She Leu
1 S 10 15
Gly Xle Ser Xle Val Gly Gin Ser Asn Glu Arg Gly Asp Gly Gly Xle
20 25 30
Tyr lie Gly Ser Xla Mst Lye Gly Gly Aie Vel Ale Ale Asp Gly Arg
35 40 45
lie Glu Pro Gly Aap Met Leu Leu Gin Val Aen Aep Met Asn Pha Glu
SO SS 60
Aan Met Ser Asn Aap Asp Ale Val Arg Val Leu Arg Aep Xle Val His
65 70 75 80
Lys Pro Gly Pro Xle Val Leu Thr Val Ale Lye Cys Trp Aep Pro Sar
85 90 95
Pro Gin Aon Ser
100
<210>33
«211>Sß
<212> PRT
<213> Homo s^pfens
<400>33
Xla Xle Thx Val Thr Leu Aen Met Glu Lye Tyr Aan. Pha Leu Gly Ile
1 5 10 15
Ser Xle Val Gly Gin Sex Asn Glu Arg Gly Asp Gly Gly Xle Tyx Xle
20 25 30
Gly Sax Xle Mat Lya Gly ßly Ale Val Ala Ala Aap Gly Arg Ile Glu
35 40 45
pro Gly Aep Met Leu Leu Gin val Asn Glu Xle Aen Phe Glu Aen Met
50 55 60
ser Asa Asp Asp Ala Vol Arg Val Leu Arg Glu Xle v«l Hls Lye Pro
65 70 75 30
Gly Pro IIa Thx &ou Thx Val Ala Lys Cys Trp Asp Pro Bex Pro
05 90 SS
EU 1537 415 Bl
2.MAR.2009 16:46 NED. OCTROOIBUREAU 43703527580 NO.075 P.15"
ACCOUNTS
158
«21034
<211>92
<2Î2> PRT
?s213> Homo sepens
<4DO>34
Ihr Thr Gl» Gin lie Aap Leu Gin Gly Pro Gly Pro Trp «ly Phe Are
1 5 10 15
Leu Val Gly Arg Siye Aep Phe Glu Gin Pro Leu Ala lie Ser Arg Val
20 25 30
Thr pro Gly Ser Lys Ala Ala ï,eu Ala Aon Leu Cya He Gly Asp Val
35 40 45
He Thr Ala Ue Aep Gly Glu Ass Thr Ser Aen Met Thr au Lea Glu
50 55 eo
Ale Gin Asn Arg II* Lys Gly Cye Thr Aap Aso Leu Thr Leu Thr Val
W 7Ö 75 gu
Ala Arg ser Glu Ole Lys val Trp ser Pro Leu Val
85 SO
<2T05-35
<2î1;>89
<212>PRT
<213> Homo sapiens
?C40O35
Zle Phe Met Asp Ser Pha lye Val Val Leu Glu Cly Pro Ala Pro Trp
1 5 10 15
Gly Phe Arg Leu Gin Gly Gly Lys Aap Phe Asa Val Pro Leu Ser XI«
20 25 30
Ser Arg Leu Thr Pro Gly Gly fcyo Ala Ala Gin Aie Gly Val Aie Val
35 40 45
Gly Asp Trp val Leu Ser Xlo Asp Gly Glu Asn Ale Gly Ser Leu Thx
50 55 go
Ste île Glu Aie Gin As» Lyo Ue Arg Ala Cys Gly Glu Arg Lau 9er
70 75 ' an
Leu Gly Leu Sox Arc Ala Gin Pro Val
85
<210>3S
<211> 1DQ
<212>PRT
«213> Homo Sc^feRS
?c<f0$>36
EU 1537 415 Bl
2.MAR.2009 16:46 NED. OCTROOIBUREAU 43703527580 NO.075 '~P.16'
ACCOUNTS
159
Glri Gly Eis Glu Leu AI» Lye Gin Glu ll« Arg vel Arg Val Glu Lys
Aap Pro Glu Lau Gly Phe Ser xi« Ser Gly Gly Val Gly Gly Arg Gly
20 25 ' ao
Aaa Pro Phe Arg Pro Aap Aap Asp Gly IIa Ph« Val Thr Arg Val Gin
33 -*0 45
Pro 61u Gly Pro Ala Sex Lys Leu Lau Gl» Pro Gly Aap Lys IIa Xle
SO 55 60
Gin Ala Aon Gly Tyr Soc Pho ue Asn Ii» Glu Bie Gly Gin Ala Val
65 7Û 78 BO
Ser Leu Leu Lys Thr Phe Gin Asn Thr Val Glu Leu Xle Ile Val Arg
85 gp 9S
Glu Val Ser Sex
100
<210>37
<211>S7
<212>PRT
<213> Homo sapiens
<400>37
IIa Leu Cya Cya Leu Gltt Lys Gly Pro Aan Gly Tyr Gly Phe Hie Lau
1 5 10 IS
Bis Gly Glu Lya Gly Lya Leu Gly Gin Tyr Xle Arg Leo Val Glu Pxo
2Ö 25 30
Gly Ser Pro Ala Glu Lys Ala Gly Leu Leu Ala Gly Aap Arg Leu Val
35 40 4$
Gl« Val Aen Gly ßlu Asn Val Glu Lya Glu Thr Hie Gin Gin Val Val
50 55 60
Ser Arg Ile Are; AI* Ala x*u Aaa aj» Val Arg Leu Leu Val Val Aep
Pro Glu Phe He Val Thx Asp 75 80
95
<210> 38
<211>32
<2J2> PRT
<2t3> Homo sapiens
<400>38
EU 1537 415 Bl
2.MAR.2009 16:47 NED. OCTROOIBUREAU 43703527580 NO.075 P.17"
ACCOUNTS
160
lie Arg Leu Gye Thr Mat hy» Lye Gly Pro Sox Gly Tyr Gly Phe Asn
15 10 IS
Leu Hie Sex Asp Lye Ser fcya Pre Gly Gin Phe Xle Arg Ser Val Asp
20 25 30
Pro Asp Ser Fro Ala Glu Ala Sex Gly Leu Arg Ala Gin Asp Arg lie
35 40 45
v»i Glu Val Aan Gly Val Cye Met Glu Gly Lys Gin Hie Gly Aap vel
50 55 60
Val Ser Ala lie Arg Ala Gly Gly Aap Glu Ihx Lye Lena Leu Val Val
65 70 75 SO
Asp Arg Glu Thx Aep Glu Phe Phe Met Asn ser Sex
85 90
<210>39
<211>1Q7
<212> PRT
<213> Harro sapiens
<4Ö0>33
Lye Asn Pro Ser Gly Gin Leu Lys Thr Val Thr Leu Ser Lye Met lys
1 5 10 IS
Gin Ser Leu Gly Xle Sex Xle Ser Gly Gly Ile Glu Ser Lys Vol Gin
20 25 30.
Pro Met Val Lye Xle Glu Lys Xle Phe Pro Gly Gly Ala Ala Pha Leu
35 40 * 45
ser Gly Ale Leu Gla» Ale Gly Phe Glu Leu Val Ala Val Asp Gly Glu
50 SS 60
Asn beu Glu Gin Vel Thx Hie Gin Arg Ala Vol Asp Thr He Arg Arg
65 70 75 60
Ale Tyr Arg Asn Lye Al« Arg Glu Pro Net Glu Leu Val Val Arg Val
8S 90 95
Pro Gly Pro Ser Pro Arg 3?x<o Sax Pro Sex Asp
10O 105
<210> 40
<211>37
<212> PRT
<213> Homo sapiens
<400>40
Glu Gly Hie Sex Ria Pro Arg Vel Vel Glu Leu Pro Lys Thr Glu Glu
15 10 is
Gly Leu Gly Phe Asn Xle Met Gly Gly Lys Glu Gin Aan Ser Pro Xle
20 25 30
Tyr Ile Ser Arg Ile Xle Pro Gly Gly lie Ala Asp Are His Gly Gly
35 40 45
i»eu Lya Arg Gly Asp Gin Leu Leu Sex Val Aan Gly Val Ser Val Glu
50 SS 60
EU 1537 415 Bl
2.MAR.2009 16:47 NED. OCTROOIBUREAU 43703527580 NO.075 P.18
ACCOUNTS
161
Gly Glu Hia Hie Glu Lys Ala Val Glu Leu Leu Lys Ale AI« sin Gly
65 70 7S 60
Lys V»l Lys Leu Val Vel Arg Tyr Thr Pro Lya Val Leu Glu Gla Met
SS 90 95
Glu
«210>41
<211>88
<212>PRT
<213> Homo sapiens
«4Q0>41
Pro Gly Ale Pro Tyr Ale Arg Lye Thr Phe Thr lie Val Gly Asp Ala
15 10 IS
Val Gly Trp Gly Phe Vel val Arg Gly Ser Lye Pro Cye Hie tie Gin
20 2S 30
Ale Val Asp Pro Sax Gly Pro Ala Ale Ale Ala 6ly Met Lya Val cya
SS 40 45
Gin Phe Val Val Ser Val Aen Gly Leu Aaa Val Leu Hie Val Aap Tyr
SO 55 60
Arg Thr Val Sec Ann Leu Ile Leu Thr Gly Pro Arg Thx Xle Val Met
65 70 7S 80
Glu Val Mat Glu Glu Lau Glu Cys
85 ,
<210>42
<211>97
<212:»PRT
<2t3> Homo sajs'sns
<400>42
Gly Gin Tyr Gly Gly Glu Thr Val Lye Xle val Arg Xle Gla Lye Ala
IS 10 IS
Arg Asp Xle Pro Leu Gly Ala Thr Val Arg Asn Glu Met Aep Ser val
20 2S 30
Xle Xle Ser Arg Ile Val Lye Gly Gly Ala Ala Glu Lye Ser Gly Lou
35 40 4S
Leu Hie Glu Sly Asp Glu Vel Leu Glu Ile Asn Gly Ile «lu Xle Ar«
50 5S 60
Gly Lye Asp Val Asn Glu Val Phe Asp Leu Leu Ser Asp Met Bis Gly
65 70 75 80
Thr Lou Thr she Vel Leu Xle Pro Ser Gin Gin Ile ï»ys Pro Pro Pro
85 90 95
Ala
<210>43
<211> S8
<212>PRT
<213> Hosro sapiens
<400:»43
EU 1 537 415 Bl
2.MAR.2009 16:47 NED. OCTROOIBUREAU 43703527580 NO.075 P.19
ACCOUNTS
162
Ile Leu Ala Hls Val Lya Gly Ile Glu Lye Glu Val Aan Val Tyr Lye
* 5 10 15
Sax Gl« Asp Sex Leu Gly Leu Thr Xla Thr Aap Asn Gly Vel Gly Tvr
20 25 SO
Ala Phe lia Lys Arg IIa Lya Aap Gly Gly Val Xle Aap Ser Val Lya
35 40 «5
Thr Ile Cy» Val Gly Aep Dis Ha Glu Ser Xle Asn Gly Glu Asn II«
50 55 60
Val Gly Trp Arg Hia Tyr Aep Val Ala Lya Lys Leu Lye Glu Leu Lya
65 70 >S JJ
Lya Glu Glu Leu Phe Thr Met Lya Leu Xle Glu Pro Lye Lya Ala Phe
öS g0 93
Glu lia
>£1G>44
<2t1> 104
<212>PRT
<213> Homo sapiens
<40S>44
Lya Pro Ser Gin Ala Ser Gly Sie Phe Ser Val Glu Lau Val Arg Gly
IS m xs
Tyr Ala Gly Phe Gly Leu Thr Leu- Gly Gly Gly Arg Aap Val Ala Gly
SO 25 30
Aap The Pro Leu Ala Val Arg Gly Lau Leu Lya Aap Gly Pro Ala Gin
35 40 45
Arg Cya Gly Arg Leu Glu Val Gly Asp Leu Val Leu Hia Xle Asn Gly
SO 55 60
Glu Ser Thx Gin Gly Leu Thx His Ale Gin Ale Val Glu Arg XI« Arg
65 70 75 SO
Ala Gly Gly Pro Gin Leu Hia Lau Val Xla Arg Arg Pro Leu Glu Tür
85 90 35
Hia Pre Gly Lya Pro Arg Gly Val
1Q0
«21D>45
<211> 107
«212>PRT
<213> Homo sapiens
<400><i5
EU 1537 415 Bl
2.MAR.2009 16:48 NED. OCTROOIBUREAU 43703527580 NO.075 P.20
ACCOUNTS
163
Pro Val Met sur Gin Cya Ala Cya Leu Glu Glu Val Bis Leu Pro Aen
1 ? s io xs
Xle Lya Pro Gly Giu Gly Leu Gly Kat Tyr lie Lye Ser Thr Tyr Aao
-, 20 2S 30
«.y Leu His Val Xle Thx sly Thr Thr Glu Ran Ser Pro Ala Aap Arg
35 40 45
Sex Gin Lya Xle Ri» Ala Gly Aap du Val Xle Gin Val Aon Gin «In
5° 55 eo
Thr Vol Val Gly Trp Gin Leu Lye Aan Lau Val Lys Lya Leu Arg Glu
65 W 75 an
Aan Pxo Thr Gly Val Val Leu Leu Lou Lye Lye Arg Pro Thr Gly 1er
_ . 85 90 95
Phe Aan Ph» Thr Pxo Glu phe Xle Vel Thr Aap
iOO \Q9
<21D> 46
<211>10D
<212a PRT
<2J3> Horn» sapiens
«400? 4fi
I*u Asp Asp Glu GlU Asp Sex Val Lys Xle lie Arg Lau Val Lys Asn
* » 10 15
Arg Oio Pro tou Gly Ala Thr Ue Lys Lya Aep Glu Gin Thr Gly Aie
20 2S
30
Xle Jj1 Al* *** lle mt *** ^y *** "* «* ^P -»»g Ser Gly
45
ton Ile His Val Gly Aap Glu Leu Arg Glu Val Aen 61y IIa Pro Val
30 sa eo
Glu Asp Lys Arg Pro Glu Glu rie Ile Gin il« Leu Ala Gin Sar Gla
65 70 75 80
Gly Ala Xle Thr Phe Lys Xla Xi© Pro Gly Sex Lys Glu Glu Thx Pro
85 90 ge
Sex Aan Sex Sar
100
<210>47
<2%.> 83
<212>PRT
<213> Homo sapiens
<4%Q\S>47
EU 1 537 415 Bl
2.MAR.2009 16=48 NED. OCTROOIBUREAU 43703527580 NO.075 P.21
ACCOUNTS
164
Vel Val Glu Leu Mat Lye Lya Glu Gly Thr Thr Leu Gly Leu Thr Vol
15 10 IS
Sex Gly Gly Xle Asp Lye Asp Gly Lys Pro Arg Vol Sex Asn Leu Arg
20 25 30
Gla Gly Gly Xle Ala Ala Arg Sax Aap Gin Leu Asp Val Gly Aep Tyr ?
35 40 AS
Xle dys Ala Val Aan Gly Xle Aon Leu Ala Lya phe Arg His Asp Glu
SO 55 60
lie tie Ser Leu Leu Lya Aan Val Gly Glù Arg Val Val Leu Glu Val
65 70 75 80
Glu Ty« Glu
<21Q>48
<211>110
<212> PRT
<2ï3> Homo sapiens
<400>48
Aro Sex Ser Val Ile Phe Arg Thr val Glu Vol Thr Lan His Lys Glu
1 S 10 is
Gly Aan Thr Phe Gly Pha Vol Xle Arg Gly Gly Ala His Aap Asp Arg
20 25 30
Asn Lya Sex Arg Pro v«l Val Xla Thr Cya Val Arg Pro Gly Gly Pro
35 4« «
Als Aap Arg Glu Gly Thr Ile Lye Pro Gly Asp Arg Leu Leu Ser Val
50 5S 60
Aap Gly Xle Arg Leu Leu Gly Thx Thr Hlo Ala Glu Ala Met Ser Xle
65 70 75 80
Lau Ly« Gin Cye Gly Gin Glu Ala Ala Leu Leu Xle Glu Tyr Aep Vel
09 90 95
Sar Vol Met Asp Ser Val Ala Thr Ala Sex Gly Asn Ser Ser
100 105 110
«c2î0>49
<211>106
<212> PRT
<2i3> Homo sapiens
<400>49
His Val Ale Thr Ale Ser Gly Pre Leu Leu Val Glu Val Ale Lys Thr
X 5 10 15
Pro Gly Ala Ses Leu Gly Val Ala Leu Thr Thx Ser Met Cye Cys Aan
20 25 30
Lys Gin Val Xle Val IIa Aap Lya Xle Lye Sex Ala Sar Xle Ala Aep
35 40 45
Arg Cye Gly Ale Leu Hls Val Gly Asp Ris Xle Leu »er Xle Asp Gly
50 55 60
Thr Sex Met Glu Tyr Cye Thr Leu Ala Glu Ala Thr Gin Phe Leu Ale
65 70 75 80
Asn Thr Thr Asp Gin Val Lye Leu Glu Xle Leu Pro Hie His Gin Thr
85 90 95
Arg Leu Ala Leu Lya Gly Pro Asn Ser 9er
100 10S
EU 1537 415 Bl
2. MAR.2009 16=48 NED. OCTROOIBUREAU 43703527580 NO.075 P.22
ACCOUNTS
165
<2ia>50
<211>97
<212>PRT
<2l3>Hoff» sapiens
<4QO>50
Thx Glu Thr Thr Glu Val Val Leu Thr Ala Asp Pro Val Thr Gly Phe
1 5 10 IS
Gly Xle Gin Leu Gin Gly Ser Val Phe Ala Thr Glu Thr Leu Sex Ser
20 25 SO
Pro Pro Leu lie Ser Tyr Xle Glu Ala Asp Sex Pro Ale Glu Arg Cys
39 40 45
Gly Val Leu Gin Xle Gly Asp Arg Val mt Ala Xle Aso Gly XI« Pro
50 55 60
Thr Glu Aap Ser Thr Phe -Glu Glu Ala Ser Gin Leu Leu Arg Asp Ser
65 70 75 80
Sar lie Thr Ser Lye Val Thx Leu Glu Xle Glu Phe Asp Val Ala Glu
83 90 95
Ser
«2T0> 51
<211> 101
<212>PRT
«*213> Homo sapiens
<40Q>51
Ala Glu Ser Val lie Pro Ser Ser Gly Thr Phe His Val Lys Leu Pro
15 10 15
Lye Lye Hie Asn Val Glu Leu Gly Xle Thr Xle Ser Ser Pro Sar 6er
20 25 30
Arg Lys Pre Gly Aap Pro Leu Val Xle Ser Asp Xle Lys Lys Gly Ser
35 40 4S
Val Ale Hie Arg Thr Gly Thr Leu Glu Leu Gly Asp Lys Leu Lou Ala
50 55 60
Xle Asp Aen Xle Arg Leu Asp Asn Cys Sax Met Glu Asp Ale vol Gin
«6 70 75 ao
Xle Leu Gin Ole cys Glu Asp Leu Val hya Leu Lys Xle Arg Lye Asp
85 90 95
Glu Asp Asn Ser Asp
200
<21Q>52
<211>B0
*212>PRT
<213> Homo sapiens
«IOO 52
EU 1537 415 Bl
2.MAR.2009 16=49 . NED. OCTROOIBUREAU 43703527580 NO.075 "P.23"
ACCOUNTS
166
He Tyr Thr Val Glu leu. Lys Arg Tyr Gly Gly Pro Leu Gly Xle Thr
IS 10 15
Ue Ser Gly Thx Glu Glu Pro Phe Asp Pro Xle Ile Ile sax Sex Leu
20 25 ' 30
Thr Lye Gly Gly Leu Ala Glu Arg Thr Gly Ala Xle His Xle Gly Asp
35 10 4S
Arg Xle Leu Ale Ho Aen Ser Sv: Ser Leu Lye Gly Lya Pre Leu Ser
50 55 60
Glu Ala Xle Hie Leu Lea Gin Bet Ale Gly Glu Thr Val Thr Leu Lys
65 70 75 80
Ile Lye Lys Gin Thr Asp Ala Gin Sex Ala
85 90
<2.C> 53
<211>95
<212> PRT
<?213> Homo sapiens
«at00>53
Xle Net 39V Pro Thr Pre Val Glu Leu Hia Lys Val Thr Leu Tyr Lye
15 10 IS
Asp Ser Asp Met Glu Asp Phe Gly Phe sex Val Ala Aap Gly Leu Leu
20 25 30
Glu Lya Gly Vel Tyr Val Lys Asn He Arg Pxo Ale Gly Pro Gly Asp
35 40 45
Leu Gly Gly Leu Ly» Pro Tyr Aap Arg Leu Leu Oln Vel Aen Ria Val
50 55 60
Arg Thr Arg Asp Phe Asp Cye Cye Leu val Val Pro Leu lie Ala Glu
65 70 75 80
Sox Gly Asn Lys Leu Asp Leu Val xle Ser Arg Asn Pro Leu Ale
85 90 95
<210>54
<211>88
<212>PRT
<213> Homo sapiens
Ser Arg Gly Cye Glu Thr Arg Glu Leu Ale Leu Pro Arg A*p Gly Gin
1 .5 10 15
Gly Arg Leu Gly Phe Glu Val Asp Ala Glu Gly Phe val Thr Kis Val
20 25 30
Glu Arg Phe Thr She Ale Glu Thr Ala Gly Leu Arg Pre Gly Ala Arg
35 40 45
Lau Leu Arg Vel Cya Gly Gin Thr Leu Pro Ser Leu Arg Pro Glu Ale
50 55 60
Ale Ale Gin Leu Leu Arg ser Ala Pro Lys val Cye val Thr Val Leu
65 70 75 80
Pro Pro Aep Glu Ser Gly Axg Pro
85
<210>55
<211>95
EU 1537 415 Bl
2.MAR.2009 16:49 NED. OCTROOIBUREAU 43703527580 NO.075 P.24
ACCOUNTS
167
<212* PRT
<2*3> Homo sapiens
<40D>05
Ala lye Ala Lys Trp Arg Gin Val Val Lou Gin Lye Ala Ser Arg Glu
IS 10 15
Ser Pro Leu Gin Phe Ser Leu Aen Gly Gly Ser Glu Lye Gly Phe Gly
20 25 30
Xle Phe Val Glu Gly Val Glu Pro Gly Sar Lys Ala Ala Aap Sex Gly
35 40 «5
Leu Lys Arg Gly Asp Gin Zle Mat Glu val Asn Gly Gin Aan Phe Glu
SO 55 60
Asn Xle Thr Phe Met Lya Ala Val Glu lie Leu Axg Aan Aan Thx His
SS 70 75 80
Lea Ala Leu Thr Val Lys Thr Asn Xle Phe Vol Phe Lya Glu Leu
85 90 95
«21C0-SS
<211»BS
<212>PRT
<2i3> Hon» sapiens
<400>56
Lau Glu Asn Val Xle Ala vya Sex Leu Lau Xle Lys ser Asn Glu Gly
l 5 10 15
Sar Tyr dy Fhe Gly Lau Glu Aap Lya AM Lys Val Pro Xle Xle Lys
20 25 30
La« Val Glu Lys Gly Ser Aan Ala Gla Met Ale Gly Bet Glu Val Gly
38 ? 40 45
Lya Lya Xle She Ala Xle Aen Gly Asp Leu Val Phe Met Arg Pro Pha
50 55 60
Asn Glu Val Asp Cys Pha Leu Lya Sar Cy» Leu Asn Sex Arg Lys Pro
65 70 75 80
Low Arg val Leu Val Sex Thr Lya 9xo
<21B>57
<211>82
<212> PRT
<2*3> Homo sapiens
<400> 57
Fro Arg Glu Thr Val Lys Xle Pro Asp Sec Ala Aap Gly Lau Gly Phe
15 10 IS
Gin Tie Arg Gly Pha Gly Pto Ser Val Val Bis Ala Val Gly Axg Gly
20 25 3D
Thr Vol Ala Ala Aie Al« Gly Leu Sia Pxo Sly Gin Cya Xle lia Lya
35 40 45
Val Aan Gly Xle Asn val Sex Lys Glu Thr als Ala Sex val Xl» Ala
50 55 60
Bis Val Thr Ala Cya Aig Lys Tyr Arg Arg Pro Thr Lye Gin Aap Ser
65 70 75 80
Xle Gin
EU 1537 415 Bl
2.MAR.2009 16:49 NED. OCTROOIBUREAU 43703527580 NO.075 P.25
ACCOUNTS
168
<21ö>58
<211>100
<212> PRT
<213> Honrto sapiera
<4QO>58
Glu Aap Phe Cys Tyr Val Phe Thr Val Glu Leu Glu Arg Gly Pro Ser
15 10 15
Gly Leu Gly Met Gly Lea xle Asp Gly Mat si« Thr Hie Leu Gly Ala
2» 25 30
Pro Gly Leu Tyr Xle Gùn Thr Leu Leu Pro Gly Sex Pro Ale Ala Ale
35 40 4S
Asp Gly Arg Leu Ser Leu Gly Asp Arg Ile Leu Glu Val Asn Gly Ser
50 55 60
Ser Leu Leu Gly Leu Gly Tyr Leu Arg Ala Vel Aep Leu Ile Arg Sia
65 70 75 80
Gly Gly Lys Lye Mat Arg Phe Leu Val Ala Lye Ser Asp val çiu The
B5 90 95
Ala Lym Lye Xlo
100
«S210> 59
<211> 103
<212> PRT
<2ï3> Homo sapiens
<400>59
Leu Thr Glu Phe Gin Asp Lye Gin xle Lye Asp Trp Lya Lys Arg Phe.
X -5 10 .15
Xle Gly Xle Arg Mat Arg Thr Xle thx Pro Sex Leu Val Asp Glu Lau
20 25 30
Lys Ala Ser Aan Pre Asp Pha Pxo Glu Val Ser Ser Gly Xle Tyr Vel
3S 40 45
Gin Glu Val Ala Pro Aan Ser Pro Ser Gin Axg Gly Gly IIa Gin Aap
50 55 60
Gly Aep Xle Xle val Lys Vel Asn Gly Arg Pro Leu vel Asp Sar Sex
65 70 75 80
Glu L«u Gin Glu Ale Val Leu Ter Glu 9er Pro Leu Leu Leu Glu Vel
85 90 ÄS
Arg Arg- Gly Asn Aap Aep Leu Leu Phe Ser Asn Ser 9er
100 105
<210>60
<211> 97
<2î2> PRT
<213> Homo sapiens
?C4QQ>60
EU 1 537 415 Bl
2.MAR.2009 16=50 NED. OCTROOIBUREAU 43703527580 NO.075 P.26
ACCOUNTS
169
Hia Lys Lys Tyr Leu Gly Lao Gin Met lata Ser Leu Thr Val Pro Leu
15 10 IS
Ser Glu Glu Leu Lya Met Hia Tyr Pro Asp Phe Pro Asp Vél Ser'ser
20 25 30
Gly Val Tyr Val Cys Lys Val Val Glu Gly Zhr Ale Ala Gin Ser Ser
35 «0 45
Gly Leu Arg Aep Bis Asp Val Xle Val Aro xle Asn Gly Lya Pro He
50' SS. 60
Ti» Thr Thr Thr Asp Val vol Lye Al« Leu Asp Ser Aep See Leu Ser
65 70 75 89
Met Ala Vel Leu Arg Gly Lya Asp Aen Leu Leu Leu Thr Vel Asn Sar
65 90 95
sex
<210>61
<211>I04
<212>PRT
<213> Homo sapiens
<4D0>61
Xla Trp Gin xle Glu Tyr xie Asp He 'Glu Arg Pro Ser Thr Gly Gly
IS 10 15
Leu Gly Pho Ser Vel Val Ale Leu Arg Ser Gin Asn Leu Gly Lys Val
20 25 30
Asp. lie Phe' Val Lye Asp Val Gin Pro Gly Ser Val Ala Asp Arg Aep
35 40 45
Gin Arg Leu Lys Glu Asn Asp Gin Xle Leu Ale Xle Aen Bi» Thr Pro
50 55 60
Leu Aep Gin Asn Xle Ser Ris Gin Gin Ale xle Ala Leu Leu Gin Gin
65 70 75 80
Thr Thr Gly Ser Lou Arg Leu Xle Val Ala Arg Glu Pro Val Hie Thr
85 90 95
Lya Sex Ser The S«x Ser Ser Glu
100
<2f0>62
<211> 78
<212>PRF
<213> Homo sapiens
<400>62
Pro Gly aie Val Glu Glu Val Glu Leu Xla Asn Asp Gly Sex Gly Leu
IS 10 IS
Gly Phe Gly xle val Gly Gly Lys Thr Ser Gly Val Val val Arg Thr
20 25 30
Xle Val Pro Gly Gly Leu Ala Aep Arg Aap Gly Axg Leu Gin Thr Gly
35 40 45
Asp Hia Xle Leu Lys Xla Gly Gly Thr Asn Vol Gin Gly Met Thr Ser
50 SS 60
Glu Gin Val Ala Gin Val Lau Arg Aso Cys Gly Asn Ser Ser
65 70 75
<21Q>63
EU 1537 415 Bl
2.MAR.2009 16=50 NED. OCTROOIBUREAU 43703527580 NO.075 P.27
ACCOUNTS
170
<211>111
<212> PRT
<213> Homo sapiens
<4W>G3
Pro Gly Sar Asp Ser Ser Leu Phe Glu Thr Tyr Asn Val Glu Leu Vel
15 10 15
Arg Lya Asp Gly Gin Ser Leu Gly Xle Arg Xle Val Gly Tyr Val Gly
20 25 30
Thx Ser His Thr Gly Glu Ala Sex Gly He Tyr Val Lye Ser Xle tie
35 40 45
Pro Gly ser Ala Ala Tyr His Asn Gly Sis Xle Gin val Aen Asp Lys
50 55 60
xle Val Ala. Val Asp Gly Val Aen Xla Gin Gly Phe Ala Asn Sis Asp
65 70 75 80
Val Val Glu Val Leu Arg Asn Ala Gly Gin Vel Val Hie Leu Thr Leu
OS 90 95
Val Arg Arg Lys Thr Ser Ser Ser Thr see Arg xle Hie Arg Asp
100 105 110
<210>64
<211> 9S
<212> PRT
<21$>Hoane sapiens
<4Q0>64
Asn Ser Asp Aep Ala Glu Leu Gin Lys Tyr Ser Lys Leu Leu Pro lie
15 10 IS
Kis Thr Leu Arg Leu Gly Val Glu val Aap Ser Phe Asp Gly Bio His
2« 25 30
Tyr Xle Ser Ser Xle Vol Ser Gly Gly Pro Val Asp Thr Leu Gly Leu
35 40 45
Leu Gin Pro élu Asp Glu Leu Lou Glu Val Asn Gly Met Gin Leu Tyx
50 53 60
Gly Lye Ser Arg Arg Giu Ala Vel Ser Phe Lou Lye Glu Val Pre Pro
65 70 75 80
Pro Phe Thr Leu val Cya Cys Arg Arg Lou phe Asp Asp Glu Ala Ser
85 90 95
<210>65
<2f 1> 182
<212> PRT
<213> Homo sapiens
<A00> 65
EU 1 537 415 Bl
2.MAR.2009 16=50 NED. OCTROOIBUREAU 43703527580 NO.075 P.28
ACCOUNTS
171
Leu Ser Sar Pro Glu Val Lya Xle Val Glu Leu Vel Lye Asp Cye Lye
IS 10 15
Gly Leu Gly Phe Sat Xle Leu Asp Tyr Gin Asp Pro Leu Asp Pro Tbr
20 2S 30
Arg Sax Val Xle Val Xle Arg Sex Lau Vol Ala Asp Gly Val Ala Glu
35 40 45
Arg Ser Gly Gly Leu Leu Pro Gly Asp Arg Leu Val Sax Val Aen Glu
50 55 60
Tyr Cys Leu Asp Asn Thr Ser Leu Ale Glu Ale val Glu lie Leu Lya
65 70 75 80
Ale val Pro Pro Gly Leu Val Bis Leu Gly Xle Cy» Ly» Pro Leu Val
85-90 9S
Glu Phe Xle Val Thx Asp
100
<21ftx66
<211> 113
<2î2> PRT
<213> Homo sapiens
<400> 66
Pro Aan Phe Ser Hie Trp Gly Pre Pro Arg II« Val Glu xle Phe Arg
1 5 10 15
Glu Pro Asn Vel 9er Leu Gly il« Ser Ile Val Val Gly Gin Thr val
20 25 3D
Xle lys Arg Leu Lys Asn Gly Glu Glu Leu Lys Gly Ile Phe Ile Lya
35 40 45
Gin Val Leu Glu Asp Sex Pro Ala Gly Lys Thr Asn Ala Leu Lye Thr
50 SS 60
Gly Asp Lye Ile Leu Glu Val 8ox Gly Val Aap Leu Gin Asn Aie Ser
65 70 75 00
Hie Ser Glu Ala Val Glu Al« Xle Lya Asn Aie Gly Aan Pro Val Val
85 90 35
Elie Xle Val Gin Ser Leu Sex Sex Thr Pio Arg val Xle Pre Asn val
100 105 UO
Hie Aen Ly» Ala Asn Ser Ser
IIS
<21û>£7
<M1>99
«212>PKT
<213> Homo sapieas
«$D0>67
EU 1537 415 Bl
2.MAR.2009 16:51 NED. OCTROOIBUREAU 43703527580 NO.075 P.29
ACCOUNTS
172
Pro Gly Glu Leu Hia Xle lie Glu Leu Glu Lye Asp Lye Asn Gly Leu
l 3 10 IS
Gly Leu Ser Leu Ala Gly Asn Lys Asp Arg Ser Arg Met Sex Xle Phe
20 25 30
Val Val Gly Xle Asn Pro Glu Gly Pro Ala Ala Ala Asp Gly Arg Met
35 40 45
Arg Xle Gly Asp Glu Leu Leu Glu xle Aan Aan Glu xl« Leu Tyr Gly
50 55 60
Arg Ser Hia Gin Aen Ala Ser Ala Ile xle Lys Thr Ala Pro Sex Lys
$5 70 75 60
vel Lye Leu Val Phe Xle Arg Aen Glu Aep Ala Val Asn Gin Met Ale
85 90 95
Asn Ser Sax
<210> 86
<211>93
<212>PRT
<213> Homo sapiens
<4Q0>se
pro Ala Thr Cye Pre lie val pro Gly Gin Glu Mob Xle Xle Glu Ile
1 5 .10 IS
Ser Lya Gly Arg Ses Gly Leu Gly Leu Sar Xle Val Gly Gly Lye Asp
20 25 30
Thr Pro l>eu Aen Ala Ile Val xle Hia Glu val Tyr Glu Glu Gly Ala
35 40 «5
Ala Ala Arg Aap Gly Arg Leu Trp Ale Gly Asp Gin Xle Leu Glu Val
50 - ,55 60
Asn Gly Vel Asp Leu Arg Aaa Ser Ser His. Glu Glu Ala Xle Thr Ale
65 70 75 80
Leu Arg Gin Thx Fro Gin Lye Vel Arg Leu Val Vel Tyr
B5 90
<210> 69
<211>103
<212>PRT
«213> Homo sapiens
«400>69
Xle' Leu Thr beu Thr Xle fcou Arg Gin Thr Gly Gly Leu Gly Ile Ser
1 5 10 .15
Ile Ala Gly Gly Lye Gly Ser Thr pro Tyr Lye Gly Aap Aap Glu. Gly
20 25 30
Xle Phe Xle 6er Arg Val ser Glu Glu Gly Pre Ala Ala Axg Ala Gly
35. 40 45
Val Arg Val Gly Aap Lya Leu Leu Glu Val Aen Gly Vel Ala Leu Gin
50 55 60
Gly Ala Glu «is Bis Glu Ala Val Glu Ala Leu Arg Gly Ala «ly Thr
65 70 75 80
Ala Val Gin Het Arg Val Trp Arg Glu Arg Het Val Glu Pxo Glu Asn
85 oo ? 95 ?
EU 1537 415 Bl
2.MAR.2009 16:51 NED. OCTROOIBUREAU 43703527580 NO.075 P.30
ACCOUNTS
173
Ale Glu Phe Xle Val Thr Asp
100
<21O70
<2ii>sr
<212>PRT
<213> Homo sapiens
<400>70
Pro Leu Arg Gin Arg Bis tfal Ale Cya Lau Ala Arg Ser Gin Arg «ly
15 10 IS
Leu Gly Phe Ser Xle Ala Gly Gly Lye Gly Ser Thr Pro Tyr Arg Ala
20 25 30
Gly Asp Ala Gly Xle Pha Val Ser Arg Xle Ala Glu Gly Gly Ala Ale
35 40 45
Hia Arg Ala Gly Thr Leu Gin Val Gly Asp Arg Val Leu Sax XI« Aan
SO SS 60
Gly Val Asp Val Thr Glu Ala Arg file Asp Hie Ala Val Sax Leu Leu
65 70 75 SO
Thr Ala Ale Ser Pro Thr lie Ale Leu Leu Leu Glu Arg Glu Ala Gly
85 90 . 95
Gly
<210> ?1
<211>10S
<212> PRT
<213> Homo sapiens
<4fJ0>71
Xle Lau Glu Gly Pro Tyr Pro Val Gla Glu lie Arg Leu Pro Arg Ala
IS 10 15
Gly Gly Pro Leu Gly Leu Sac Xle Val Gly Gly Sex Asp als Ser Ser
20 25 30
Kla Pro Phe Gly Val Gin Glu Pro Gly Val Phe Xle Sar Lys Vel Leu
35 40 45
Pro Arg Gly Leu Ala Ala Arg Ser Gly Leu Arg Val Gly Asp Arg Xle
SO 35 60
Leu Ale Vel Asa Gly Gin Asp v«l Arg Asp Ala Thr Bis Gin Glu Ala
65 70 75 SO
Val Sex Ala Leu Leu Arg Pro Cys Leu Glu Leu Ser Leu Leu Val Arg
SS 90 95
Arg Aap Pro Ala Glu Phe IIa Val Thr Aap
100 105
<210> 72
<211> Î05
<212>PRT
<213> Homo sapiens
<4fl0>72
EU 1537 415 Bl
2.MAR.2009 16:55 NED. OCTROOIBUREAU 43703527580 NO.076 P.2
ACCOUNTS
174
Arg Glu Leu Cya Ile Glu Lye Ala Pro Gly Glu Arg Leu Gly Xle 8er
% 5 10 IS
Xle Arg Gly Gly Ala Arg Gly Bio Ala Gly Asn Pro Arg Aap Pro Thr
ZO 25 30
Asp Glu Gly Xle Phe Xle Ser Lye Val Ser Pro Thr Gly Ale Ala Gly
35 40 43
Arg Asp Gly Arg Leu Arg Val Gly Leu Arg Leu Leu Glu Val Aen Gin
SO 55 60
Gin Ser Leu Leu Gly Leu Thr Bis Gly Glu Ale Val Gin Leu X*u Arg
65 70 75 80
Ser Val Gly Asp Thx Leu Ihr Vsl Leu Val Cye Asp Gly Phe Gl» Ala
BS 90 95
Ser Thr Aep Ala Ala Leu Glu Val Sex
100 10S
<210>73
<211>91
<212> PRT
<2l 3> Homo sapiens
<4ÖQ>?3
Pro nie Gin Pro xie val Xle Bis ser Ser Gly Lye Aen Tyr Gly Phe
1 S 10 15
Thr Xle Arg Ala Xlo Arg Val Tyr Val Gly Asp S«x Asp Xle Tyr Thr
20 25 30
Vel Sia His Ile Vel Trp Asn Val Glu Glu Gly Ser Pro Ala Cya Gin
35 40 43
Aie Gly Leu Lys Ala Gly Aap Lau Xla Thx Bis Xle Asn Gly Glu Pro
SO SS 60
Val Hia Gly Leu Val Eis Thx Glu Val II« Glu Leu Lau Lau Lye Ser
65 70 75 BO
Gly Aen Lye Val Sex Xlo Thr Thx Thr Pro Phe
65 90
<210>74
<211> 105
*212> PRT
<213> Homo sapiens
<400>74
EU 1537 415 Bl
2.MAR.2009 16:55 NED. OCTROOIBUREAU 43703527580 NO.076 P.3
ACCOUNTS
175
Xle Leu Ala Cye Ala Ala Lye Ala Lya Arg Arg Leu Het Tbr Leu Thx
15 10 15
Lya Pro Ser Arg Glu Ale Pro Leu Pro Pbe Xla Leu Leu Gly Gly Sex
20 25 30
Glu Lye Gly Phe Gly Xle Phe val Asp Ser Val Asp Sex Gly Ser Lys
35 40 45
Ala Thr Glu Ala Gly Leu Lye Arg Gly Asp Gin Xle Leu Glu Vel Asn
50 ?- 55 60
Gly Gin Asn Phe Glu Aen Xle Gin Leu Sex Lys Ala Met Glu Xle Leu
65 70 75 80
Arg Asn Asn Thr His Leu Ser Xle Thx Val Lya Thr Asn Leu Phe Val
85 90 95
Phe Lye Glu Leu Leu Thr Asn Sex Sex
100 105
<210>75
<211>88
<212> PRT
<213> Homo sapiens
-i*a0>75
Xle Pxo pro Ale Pro Arg Lys Val Glu Met Arg Arg Aap Pro Vel Leu
LS 10 15
Gly Phe Gly Phe Val Ala Gly Ser Glu Lye Pro Val Val Val Arg Ser
20 25 30
Val Thr Pro Gly Gly Pro Sex Glu Gly Lya Leu IIa Pro Gly Asp Gin
35 40 45
Ile Val Met Ile Asn Asp Glu Pro Val Sut Ala Ala Pro Arg Glu Arg
SO 55 60
Val Xle Asp Leu Vel Arg Ser Cya Lys Glu Sex Xle Leu Leu Thr Val
63 70 75 80
He Gin Pro Tyr Pro Ser Pro Lys
85
<21G>75
<211> 101
<212>PRT
<213> Homo sapiens
?c400>76
EU 1 537 415 Bl
2.MAR.2009 16=56 NED. OCTROOIBUREAU 43703527580 NO.076 P.4
ACCOUNTS
176
Leu Aaa Lye Arg Thr Thr Mot Pro Lya Asp Ser Gly Ala Leu Leu Gly
1 S 10 IS
Leu Lye Val Val Gly Gly Lys Net Thr Asp Lau Gly Arg Leu Gly Ala
20 25 30
Phe Xle Thr Lye Vol Lye Lye Gly Ser Leu Ala Asp Val Val Gly Hi»
35 40 45
Leu Arg Ala Gly Asp Glu Val Leu Glu Trp Aan Gly Lya Pro Leu Pxo
50 55 60
Gly Ala Thr Aen Glu Glu Val Tyr Asn Xle Xle Leu Glu Ser Lye Sex
65 70 73 80
Glu Pro Gin Val Glu Xle Xle Val Ser Arg Pro Xle Gly Aap Xle Pro
85 90 95
Arg Xle Hia Arg Asp
. ioo
«21G>77
<211>79
<212>PRT
<213> Homo sapiens
<40Q>77
Gla Arg Cye Val Ile Xle Gin Lye Aep Gin Bis Gly Phe Gly Pha Thr
IS 10 IS
Val Ser Gly Aap Arg Xle Val Leu Val Gin Ser Vol Arg Pro Gly Gly
20 22 30
Ale Ala Met Lys Al* Gly Val Lye Glu Gly Asp Axg lie Xle Lya Vel
35 40 <5
Asa Gly Thr Met Val Thx Asn Sex Ser His Leu Glu Val Val Lys Leu
SO 55 60
Xle Lye Ser Gly Ala Tyr Val Ala, Leu Thr Leu Leu Gly Ser Ser
63 70 75
<210>78
<211>67
<212> PRT
<2l3s» Home sapiens
<400>78
lie Leu Val Gin Arg Cye Vol Xle Xle Gin Lya Asp Asp Aon Gly Phe
15 10 IS
Gly Leu Thr Val Sex Gly Aap Aen pxo Val Phe vol Gin Ser val Lye
20 -25 30
Glu Aap Gly Ala Ala Mat Arg Als Gly Val Gltt Thr Gly Asp Arg Xle
3S 40 43
Ile Lys Val Asn Gly Thr Leu Val Thr Kis Ser Asn Hie Leu Glu Val
50 55 eo
Vol Lys Leu Xle Lys Sex Gly Sex Tyr Vel Ala Leu Thr Val Gla Gly
65 70 75 80
Arg Fro Pro Gly Asn Ser Sex
BS
EU 1537 415 Bl
2.MAR.2009 16:56 NED. OCTROOIBUREAU 43703527580 NO.076 P.5
ACCOUNTS
177
?<2icp>re
<211>79
<212>PRT
<213> Homo sapiens
<4Q0>79
Sex Val Gla Hat Thr Leu Arg Arg Aan Gly Leu Gly Gin Leu Gly Phe
15 10 IS
Hia Val Aan Tyr Glu Gly Xla vel Ala Aap Val Glu Pro Tyr Gly Tyr
20 23 30
Ala Trp Gin Ala Gly Leu Arg Gin Gly Ser Arg Leu Val Glu Xle Cya
35 40 45
Lys Val Ala Val Ala Thr Leu Sex Bid Glu Gift Met Xle Asp Leu Leu
30 SS 60
Arg Thx Ser Val Thr Val Lye Val Val Xle Xle Pre Pro Bis Aap
SS 70 75
<Z10>Ba
<211>95
«212? PRT
<2i3> Homo sapiens
<4QOi
Leu Lye val Met Thx Sex Gly Trp Glu Thx Val Asp Net Thr Lou Arg
15 10 IS
Arg Aan Gly Leu Gly Gin Leu Gly Phe Sis Val Lye Tyr Asp Gly Thr
20 25 30
Val Ala Glu Val Glu Asp Tyr Gly Phe Ala Trp Gin Ala Gly Leu Axg
35 «0 45
Gin Gly Ser Arg Leu Val Glu Xla Cys Lya Val Ala Val Val Thr Lau
SO 55 , GO
Thx ilia Asp Oln Met Xle asp Leu Leu Arg Thx Ser Val Thv Val Lya
65 70 75 80
val val Xle Xle Pro Pro Sho Glu Aap Gly Thr Pro Axg Axg dy Trp
8$ 90 95
<210>81
<211> 105
<212>PRT
<213> Homo sapiens
?c400>81
EU 1 537 415 Bl
2.MAR.2009 16=56 NED. OCTROOIBUREAU 43703527580 NO.076 P.6
ACCOUNTS
178
His Tyr Xle Phe Pro Hie Ala Arg Xle Lys Ue Thr Axg Asp Ser Lye
15 10 IS
Asp His Thr Val Ser Gly Asn. Gly Leu Gly Xle Arg lie Val Gly Gly
20 25 30
Lys Glu Xle Pxo Gly Hia Sex Gly Glu Xla Gly Ala Tyr Xla Ala Lys
35 40 45
Xle Leu Pro Gly Gly Ser Ala Glu Gin Thr Gly Lye Leu Met Glu Gly
50 55 60
Met Gin Vel Lau Glu Txp Aan Gly Xle Pro Leu Thr Ser Lys Thr Tyr
65 70 75 60
Glu Glu Val Gin Ser Ile Xla Ser Gûn Gla Ser Gly Glu Ala Glu Xle
85 90 95
Cye Val Arg Leu Asp Leu Asn Met Leu
100 105
<21Q>fi2
<211*1Ö3
«212* PRT
<213> Homo sapiens
<400> 32
Leu Cys Gly Sex Leu Arg Pro Pre Xle Val Xle Hia Sax Ser Gly Lys
15 io 15
Lys Tyr Gly Phe Ser Leu Arg Ala Xle Arg Val Ty* Met Gly Aap Sex
20 25 3D
Asp Val Tyr Thx Val His His Val Val Trp Ser VOX Glu Aep Gly Str
35 40 45 ,
Pro Ala Gin Glu Ala Gly Leu Arg Ala Gly Asp Leu Ile Thx Hia Xle
50 53 60
Asn Gly Glu Sex val Lau Gly Leu Val His Met Asp Val vel Giu Leu
6S 70 75 80
Leu Leu Lya Ser Gly Asn Lys Xle Sex Lao Axg Thr Thx Ala Leu Glu
85 90 '93
Asn Thr Sex Xle Lye Val Gly
100
<210>83
<211>85
«212» PRT
<Q.\Z> Homo sapiens
<400>B3
EU 1537 415 Bl
2.MAR.2009 16=57 NED. OCTROOIBUREAU 43703527580 NO.076 P.7
ACCOUNTS
179
Ser Tyr Sex Val Thr Leu Thr Gly Pre Gly Pro Trp Gly Phe Arg Leu
IS 10 IS
Gin Gly Gly Ztya Asp Phe Asn Met Pro Leu Thr lie Ser Arg Xle Thr
20 25 30
Pro Gly Gar Lys Ala Ala Gin Sex Gin Leu Ser Gin Gly Aep Leu Val
35 40 45
Val Ala Xle Asp Gly val Asn Thr Asp Thr Met Thr »le Leu Glu Ale
SO 55 60
Gin Asn Lya lie Lye 3er Ala Ser Tyr Asn Leu Ser Leu Thr Leu Gin
65 70 75 60
Lye Sex Lye Asn Sex Ser
85
<210>84
<2!1>91
<212> PRT
<213> Homo sapiens
<400>84
Xle Sox Axg: Asp Sex Gly Ala Met Leu Gly Leu Lys Val Val Gly Cly
15 10 15
Lye Met Thr Glu 9er Gly Arg Leu Cys Ala Pha Xle Thx Itya Val Ly»
20 25 30
Lye Gly Sex Leu Ala Asp The Val Gly Bis Lau Arg Pro Gly Asp Glu
35 ? ? 40 45
Val Leu Glu Tip Asn Gly Arg Leu Leo Gin Gly Ala Thr Pfco Glu Glu
SO 55 60
Val Tyr Aen xle Xle Leu Glu ser Lys Pro Glu Pro Gin Val Glu Leu
65 70 75 80
Val Val Ser Arg Pro Ue Ala lie His Arg Asp
85 90
<210>85
<211>101
«212> PRT
<213> Homo sapiens
<400>85
EU 1537 415 Bl
2.MAR.2009 16=57 NED. OCTROOIBUREAU 43703527580 NO.076 P.8
ACCOUNTS
180
Xle Sex Ala Leu Gly Box net Arg Pre Pro lie Xla Xle Hie Arg Ala
IS lo is
Gly Lys Lya Tyr Gly Phe Thx Leu Arg Ala lie Arg Val Tyr Mat Gly
20 25 30
Asp See Aep Val Tyr Thr Val Hie Hie Met Val Trp flia Val Glu Asp
33 40 4S .
Gly Gly Pro Ala Sex Glu Ala Gly Leu Arg Gin Gly Asp Leu Xle Thr
50 55 GO
Hie Val Asn Gly Glu Pro Val Hia Gly Leu Val Hie Thx Glu Val Val
65' 70 75 80
Glu Leu- Xle Leu Lya Sex Gly Asn Lye Val Ala Xle Sax Thr Thr Pro
85 dO 95
Leu Qlu Asn Sex Sex
100
<210>S6
<m>94
<212>PRT
<213> Homo sapiens
<400>86
She Sox Asp Met Arg Ile Sex Xle Aen Gin Thr Pro Gly Lye Ser Leu
15 10 IS
Asp Phe Gly Phe The lie Lys Trp Aap Ile Pro Gly lie Phe Val Ala
20 25 30
Ser Val Glu Ala Gly Ser Pro Ala Glu Phe Sex Gin Leu Gin Val Asp
35 40 45
Asp Glu lie lie Ala lie Aen Asn Thr Lys Phe Ser Tyr Asn Asp Ser
SO 53 60
Lye Glu Trp Glu Glu Ala Met Ala Lye Ala Gin <31o Thx Sly His Leu
65 70 '75 80
Val Met. Asp Vel Arg Arg Tyr Gly Lye Ala Gly Sex Pro Glu
05 30
«218>87
<211>98
<212>PRT
<2f3> Ho«» sapiens
<400>87
Gin Sex Ala Hip Leu Gll) Val He Gin Leu Ala Asn lie Lys Pro Ser
1-5 10 15
Glu Gly Leu Gly Met Tyr Xle. Lye Ser Thr Tyr Asp Gly Leu Rie Val
20 25 30
Xle Thr Gly Xhr Thr Glu Aan ser Pre Ala Asp Axg Cyo Lya Lya Xle
35 40 45
Hie Ala Gly Asp Glu Val Xle Gin Val Aan fH9 Gin Thr Val Val Gly
SO 5S 6Q
Trp Gil» Leu Ly» Aan Irfau Val Asn Ale Leu Arg Glu Asp Pro Sex Gly
65 70 7g so
EU 1537 415 Bl
2.MAR.2009 16=57 NED. OCTROOIBUREAU 43703527580 NO.076 P.9
ACCOUNTS
181
Val Xle Leu Thr Leu Lya Lys Arg Pro 61» Sor Met Leu Thr Sex Ala
85 90 SS
Pre Ala
<210>S8
<211> 100
<212>PRT
<213> Homo sapiens
<400>86
He Leu Thr Gin Thr Leu xle Pro Vsl Arg His Thr Val Lye xle Asp
15 10 IS
Lya Asp Thr Leu Leu Gin Asp Tyr Gly Phe aie Xle ser Glu Ser Leu
20 23 30
Pro Leu Thx Val Val Ala Val Thr Als Gly Gly Ser Ale Bis Gly Lys
33 40 45
Leu Phe Pro Gly Aap Gin Xle Lea Gin Met Asn Asn Glu Pro Ala Glu
. SO 55 60
Asp Leu Ser Trp Glu Arg Ala Val Asp Xle Leu Arg Glu Ala Glu Aep
65 70 7S 80
Ser Leu Ser Xle Thr Val Val Arg Cys Thr Ser Gly Vel Pro Lye Ser
05 90 35
Ser Aen Ser Sex
100
<210>89
<211>93
<212> PRT
<21S> Homo sapiens
«4Q0>89
Gly Leu erg Ser Pro lie Thr Xle Gin Arg Sex Gly Lye Lya Tyr Gly
i s 10 is
Phe Thr Leu Arg Ale Xle Axg Val Tyr Mat Gly Asp Thr Aap Val Tyr
20 25 30
Sex Val Sia Eis Xle Val Trp Hie Val Glu Glu Gly Gly Pro Ala Gin
35 40 45
Glu Ala Gly Leu Cya Ale Gly Aap Leu Ile Thr Bis val Asn Gly Glu
SO S3 60
Pxo Val (de Gly Met Val Rie Fro Glu Val Val Glu Leu Xle Leu Lya
65 70 75 80
Ser Gly Asn Lys Val Ala Val Thr Thr Thr Pro Phe Glu
85 90
<210?BÖ
<211> 107
<212> PRT
^IS* Homo sspiais
<4Û0>90
EU 1537 415 Bl
2.MAR.2009 16=58 NED. OCTROOIBUREAU 43703527580 NO.076 P.10
ACCOUNTS
182
Glu Gly Glu Glu Thr Lya Ser Leo Thr Leu Val Leu Hie Axg Asp Ser
15 10 IS
Gly Sax Leu Gly Phe Asn Xle Xle Gly Gly Axg Pro Sex Val Asp Asn
20 25 30
His Asp Gly Sex Sex Sor Glu Gly Xle Phe Val Ser Lys lie Val Asp
35 . 40 43
Sex Gly pro Ala Ale Lye Glu Gly Gly Leo Gin lie Bis Asp Arg lie
50 55 60
Xle Glu Vel Asn Gly Arg Asp Leu aar Arg Ala Thx nie Asp Gin Ala
65 70 75 60
val Glu Ala Ph« Lys Thr Ala Lys Glu Pro xle val Val Gin Val Leu
85 90 95
Arg Arg Thx Pro Arg Thr Lye Met Phe Thx Pro
100 103
«210>91
<c211>101
<212>PHT
«213> Homo sapiens
«400*91
Gin Glu Mat Asp Axg Glu Glu Leu Glu Leu Glu Glu Val Asp Leu Tyr
'1 5 10 IS
Arg Met Asn Ser Gin Aap Lya Lou Gly Lou Thx Val Cya Tyr Arg Thr
20 25 30
Asp Aep Glu Asp Asp Xle Gly Xle Tyr lie Ser Glu Xle Asp Pro' Asn
35 40 4S
Ser lie Ale Ala Lye Aap Gly Arg Xle Arg Glu Gly Aap Arg Ho Xle
50 53 60
Gin lie Aan Gly Xle Glu Val Gin Aan Arg Glu Glu Ale Val Ala Leu
65 70 75 SO
Lau Thr Sex Glu Glu Aan Lya Aan Phe 5er Leu Leu Ile Ala Axg Pro
B5 90 ,-. 95
Glu Leu Gin Leu Aap
100
<210>92
<211>91
<212>PRT
<213> Homo sapiens
<4Q0>92
EU 1537 415 Bl
2.MAR.2009 16=58 NED. OCTROOIBUREAU 43703527580 NO.076 P.11
ACCOUNTS
183
Arg Sex Pho Gin Tyr Val Pro Val Gin Leu Gin Gly Gly Ala Pxo Txp
1 3 10 15
Gly Phe Thx Leu Lys Gly Gly Leu Glu Ria cya Glu Pro Leu Thr Val
20 25 30
Sex Lys Xle Glu Asp Gly Gly Lya Ala Ala Leu Sex Gin Lye Met Arg
35 40 45
Thx Gly Asp Glu Leu Val Asn xle Asn Gly Thr pro Leu Tyr Gly Sex
50 S3 60
Arg Gin Glu Als Leu xle Leu Xle Lys Gly Ser Phe Arg Xle Leu Lys
65 70 75 80
Lau Xle Val Arg Arg Arg Asn Ala Pro val Ser
8S 90
<210>93
<211> 102
<212> PRT
<213> Homo salens
<400>33
Xla Lau Gin Lys Leu Glu Leu Phe Pxo Vol Glu Leu Glu Lys Asp Glu
IS 10 IS
Asp Gly Leu Gly Ile Ser XI9 Xle Gly Met Gly Vel Gly Ala Asp Ala
20 25 30
Gly Leu Glu Ly» Leu Gly Xle Phe Val Lya Thr Vel Thr Glu Gly Gly
35 40 «S
Ala Ala Glc Arg Asp Gly Arg Ile Gin Val Asa Asp Gin Xle Val Glu
50 55 60
Val Asp Gly Xlo Ser LOU Val Gly val Thr Gin Aen Phe Ala Ala TAX
65 70 75 60
Val Lau Arg Asn Thr Lys Gly Asn Val Arg Phe Val Ile Gly Arg Glu
65 90 95
Lye Pre Gly Gin vel Ser
100
<210>94
<211>113
«212> PRT
<213> Homo sapiens
<400>94
EU 1537 415 Bl
2.MAR.2009 16=58 NED. OCTROOIBUREAU 43703527580 NO.076 P.12
ACCOUNTS
184
Lys Asp Val Aan Val Tyr Val Aan Pro Lys Lys Leu Thr vel Xle Lya
15 10 15
Ale Lys Glu Gin Leu Lys Leu Leu Glu val Lea vel Gly Xle Xle Ris
20 25 30
Gin Thr Lys Trp Ser Trp Arg Arg Thr Gly Lys Gin Gly Aep Gly Glu
3S 40 45
Arg Leu Val Val Sis Gly Leu Leu Pro Gly Gly Ser Ala Met Lye Sex
50 35 60
Gly Sie Val Leu Xle Gly Aap Val Leu val Ala Vel Asn 'Asp val Asp
65 70 75 80
Val Thr Thr Glu Aan Xle Glu Arg Vel Leu Sex eye Xle Pro Gly Pro
85 90 SS
Met Gin Val Lya Leu Thr Phe Glu Aan Ala Tyr Aap Vel Lye Arg Glu
100 105 110
Thr
<210>95
<211s-9Q
<212> PRT
«213> Hon» sapiens
<4Ö0>35
Thr Arg Gly Cys Glu Thr Val Glu Met Thr Leu Arg Arg Aan Gly Leu
1 5 10 ,13
Gly Gin Leu Sly Phe Hia Val Aa» Phe Glu Gly Xle Val Ala Asp Vel
20 25 30
Glu Pre Phe Gly Phe Ala Trp Lys Ala Gly Leu Arg Gin Gly Ser Arg
35 40 45
Leu Val Glu Xle Cye Lye Val Ala Val Ala Thr Leu Thr nis Glu Gin
50 35 60
Met Xle Aap Leu Leu Arg Thx Sex Val Ihx Vel Lys Vel Vel lie Xle
63 70 75 60
Gin Pro Sia Asp Asp Sly Ser Pro Arg Arg
B5 90
<210>95
<211>96
«212>PRT
<213> Homo sapiens
<400> 96
Val Glu Aon Xle Leu Ala Lys Arg lau Leu lie Lett Pro Gin Glu Glu
1 S IQ' 15
EU 1 537 415 Bl
2.MAR.2009 16=59 NED. OCTROOIBUREAU 43703527580 NO.076 P.13
ACCOUNTS
185
Asp Tyr Gly Phe Asp Xle Glu Giu Lya Aen Lye Ala Val Val Val Lys
20 .25 30
Ser Val Gin Arg Gly Ser Leu Ala Glu Val Ala Gly Leu Gin val Gly
33 40 45
AT? Lys Ile Tyr Sex Xle Asn Glu Asp Leu Val Phe Leu Axg Pro Pha
SO S3 60
Ser Glu Val Glu Sex Xle Leu Asn Gin Sex Phe Cya Ser Arg Atg Pro
6S 70 75 80
Leu Arg Leu Leu Val Ala Thx Lys Ala Lys Glu Ile Ile Lys Xle Pro
85 SO S3
<21ö>97
<211> 103
<212> PRT
<213> Homo saferes
<SQ0>97
Pro Asp sex Ala Gly Pro Gly Glu val Arg Leu val Set Leu Arg Arg
15 10 IS
Ala Ly» Ala Hie Glu Gly Leu Gly Phe 3er Xle Arg Gly Gly Ser Glu
20 25 30
His Gly val Gly Xle Tyr Val Ser Leu Val Glu Pro Gly Ser Leu Ala
35 40 45
Glu Lys Glu Gly Leu Arg Val Gly Aep Gin Ile Leu Axg Vel Asn Aep
SO SS 60
Lys 3er Leu Ala Arg Val Thx Kis Ala Glu Ala Val Lya Ala- Leu Lys
65 70 75 80
Gly Ser Lys Lys Leu Val Leu Ser Val Tyr Ser Ala Gly Arg Xle Pro
SS 90 35
Gly Gly Tyr val Thr Aen sis
> ioo
<210>98
<211> 100
«Z12> PRT
<213> Homo sevens
<40ö>38
Leu Gin Gly Gly Asp Glu Lye Lya Val Asn Leu Val Leu Gly Aep Gly
1 5 10 IS
Axj Sex Leu Gly Leu Thr Xle Arg Gly Gly Ala Glu Tyx Gly Leu Gly
20 25 30
Ile Tyr Ile Thx Gly Val Aep Pro Gly Sax Glu Ala Glu Gly Ser Gly
35 40 «5
Leu Lys Val Gly Asp Gin Ile Leu Glu Val Aan Trp Arg Sex Phe Leu
50 SS . 60
Asn Xle Leu Hie Asp Glu Ala Val Arg Lau Leu Ly« Ser Sex Arg Bis
6S 70 73 80
Leu Xle Leu Thr Val Lye Aap Vol Gly Arg Leu Pro Hie-Ala Arg Thr
.85 90 93
Thr Val Asp Glu
100
EU 1 537 415 Bl
2.MAR.2009 16=59 NED. OCTROOIBUREAU 43703527580 NO.076 P.14
ACCOUNTS
186
<210>99
<211>87
<212> PRT
<213> Homo sapiens
<400> 9»
Trp Tbr Ser Gly Ala Hie Val Sis Ser Gly Pro Cys Glu Glu.Lys Cys
IS 10 IS
Gly Aie Pxo Gly His Arg Gin Pro Leu Pro Arg Xle val Thr lie Gin
20 25 30
Arg Gly Gly Ser Ala file Aen Cys Gly Gin Leu Lya Val Gly His Val
35 40 45
Xle Leu Glu Val Asn Gly Leu Thr Leu Arg Gly Lye Glu His Arg Glu
SO 55 60
Ala Ala Axg xle lie Ala Glu Ala Phe Lys Thr Lye Asp Arg Aap Tyr
65 70 75 . 80
Xla Asp Phe Leu Aap Ser Leu
65
<210>100
<311> 100
<212>PRT
<213> Homo sapiens
<400>100
Glu Leu Arg Arg Ale Glu Lou Val Glu Xle Xle Val Glu Thr Glu Ala
15 10 IS
Gin Thr Gly Val Sex Gly Xle Asn Val Ala 'Gly Gly Gly Lys Glu «ly
20 25 30
Xle Phe Val Axg Glu Leu Arg Glu Asp Sor Pro Ala Ala Arg Ser Leu
35 . 40 45
Ser Leu Gin Glu Gly Aap Gin Leu Leu Sex Ala Axg Val Phe Phe Glu
50 S3 60
Aan Pha Lya Tyr Glu Aap Ala Lea Axg Lau Lau Gin Cya Ala Glu Pro
63 70 75 80
Tyr Lya Val Ser Phe Cya Leu Lye Arg The Val Pro Thr Gly Asp leu
85 90 95
Ala Leu Arg Pro
100
<2.10> 101
<211> 102
<212>PRT
<213» Homo sapiens
<4W> ÏQ1
EU 1537 415 Bl
2.MAR.2009 16=59 NED. OCTROOIBUREAU 43703527580 NO.076 P.15
ACCOUNTS
187
Pxo Ser Gin X*eu Lye Gly Val Leu Vel Arg Ala Ger Leu Lys Lye Ser
IS 10 IS
Thr Met Gly Phe Gly Phe Thr Xle Xle Gly Gly Asp Arg Pro Asp Glu
20 2S 30
Phe Leu Gin Val Lys Asn Val Leu Lye Aap Gly Pro Ala Ala Gin Asp
3S 40 45
Gly Lye Xle Ala Pro Gly Asp Val IIa Val Aap Xle Asn Gly Asn Cys
SO SS 60
Vel Leu Gly His Thr Hie Ala Asp Val Val Gin Met Phe Gin Leu Val
6S 70 73 80
Pro Val Asn Gin Tyr Val Asn Leu Thr Leu Cys Arg Gly Tyr Pre Leu
85 90 95
Pro Asp Aap Ser .Glu Aap
100
<210> 102
<211>100
<212>PRT
<213> Homo sapiens
<40O>102
Ale Sex Sex Gly Ser Ser Gin Pro Glu Leu Val Thr lie Pro Leu Xle
15 10 IS
Lys Gly Pxo Lye Gly Pha Gly Phe Ala He Ala Aap Sex Pro Thr Gly
20 25 30
Gin Lys val Lys Met Xle Leu Aap 5er Gin Trp Cye Gin Gly Leu 6in
35 40 45
Lye Gly Asp Xle He Lys Glu Xle Tyr file Gin Aen Val Gin Aan Leu
SO S3 60
Thr Hie Leu Gin val Val Glu Val Lou Lys Gin Fhe Fro Vel Gly Ala
65 70 TS 80
Asp Val Pro Lau Leu Xle Leu Arg Gly Gly Pro Pro Ser Pro Thr Lys
85 - 90 95
Thr Ala Lys Mat
100
<210> 103
«2U>143
<2.2>PKY
<213> Homo sapïens
<400> 103
EU 1537 415 Bl
2.MAR.2009 16=59 NED. OCTROOIBUREAU 43703527580 NO.076 P.16
ACCOUNTS
188
Leu Tyr Glu Asp Lye Pro Pro Leu Thr Aen Thx Phe Leu Xla Ser Aen
IS 10 15
Pro Arg Thr Thr Ala Asp Pro Arg Xle Leu Tyr Glu Asp Lye Pro Pro
20 25 30
Asn Thr Lya Asp Leu Asp Val Phe Leu Arg Lya Gin Glu Ser Gly Phe
35 40 45
Gly Phe Arg Val Leu Gly Gly Aap Gly Prd Asp Gin Ser Xle Tyr Xle
50 SS 60
Gly Ala xle Xle Pro Leu Gly Ala Ala Glu Lys Asp Gly Arg Leu Arg
65 70 7S 80
Ala Ala Asp Glu Leu Met Cys Xle Asp Gly Xle Pro Vol Lys Gly Lys
85 90 95
Ser Ris Lye Gin Val Lau Asp Lee Mat Thr Thr Ale Ale Axg Aan dy
100 LOS HO
Hie Vel Leu Lee Thr Val Arg Arg Lya IIa Phe Tyr Gly Glu Lys Gin
115 120 125
Pro Glu Asp Asp 8er Gly Ser Pro Gly Xlo Hie Axg Glu Leu Thr
130 135 140
<210>104
<211> 102
<212>PRT
<213> Homo sapiens
<4öo> ioa
Pro Ala Pro Gla Glu Pro Tyr Asp Val Val Lau Gin Axg Lya Glu Aan
l 5 10 15
Glu Gly Phe Gly Phe Val Xle Leu Ihr 5er Lye Aen Lys Pro Pro Pro
20 25 30
Gly Val xle Pro Kis Lya Xle Gly Arg val Xle Glu Gly Ser Pro Ala
35 . ? 40 4S
Asp Arg Cye Gly Lye Leu Lye val Gly Asp Ris Xle Sex Ale val Asn
SO SS 60
Gly Gin Sex Xle Val Glu Lau Sex Hia Asp Asn Xle Val Gin Leu He
5S 70 75 80
Lys Aap Ala Gly Vel Thr Val Thr Leu Thx Val Xle Ala Glu Glu Glu
85 90 95
Hia His Gly Pre Pre Ser
100
<210> 105
<211>98
<212>PRT
<213> Homo sapiens
«4Û01GS
EU 1537 415 Bl
2.MAR.2009 17=00 NED. OCTROOIBUREAU 43703527580 NO.076 P.17
ACCOUNTS
189
Gla Asn Leu Gly Cya Tyr Pro val Glu Leu Glu Aro: SLy Pro Arg Gly
15 10 15
Phe Gly Phe Sec Leu Ar$ Gly Gly Lya Qlu Tyr Aen Mat Gly Leu Hn
20 25 30
Ue Leu Arg Lao Ale Glu Aep Gly Pro Ale Xla Lys Asp Gly Axg Xle
35 40 45
Hie Val Gly Asp Gin Xle Val Glu lie Asn Gly Glu Pro Thr Gin Gly
SO 9» 60
Xle Thx Hia Thx Axg; Ala Xle Glu Leu Xle Gin Ala Gly Gly Asn Lys
65 70 ' 75 80
Val Leu Leu Leu Leu Arg Pro Gly Thr Gly Leu Xle Pro Asp Hie Gly
65 90 95
xeu Ala
<210> 1QS
<211>&4
<212> PRT
<213> Homo seitens
<400>106
He Thr Val val Gla Leu Xle Lya Lys Glu Gly Ser Thx Lau Gly Leu
IS 10 15
Thr Xle Sor Gly Gly Thr Asp Lys Aap Gly Lys Pro Arg Vel Ser Asn
20 2S 30
Leu Arg Pro Gly Gly Leu Ala Ala Arg Ser Asp Leu Lou Ase Xle Gly
35 40 45
Asp Tyr Xle Arg Ser Val Asn Gly Xle Hia Leu Thx Axg Leu Axg Hia
50 55 ? ?0
Asp Glu Xle Ile Thr Leu Leu Lys Asa Val Gly Gin Arg Vel Val Lau
65 70 75 90
Glu Val Glu Tyr'
<21D>107
<211>92
<212> PRT
<213> Homo sapiens
<4D0> 107
'Ile Leu Asp Val Ser Leu Tyr Lys Glu Gly Asn Ser Phe Gly Pha Val
15 10 15
Lau Arg Gly Gly Ala Hia Glu Aap Gly His Lys Sex Arg Pro Leu Val
20 25 30
Lau Thr Tyr Val Arg Pro Gly Gly Pro Ala Aap Arg Glu Gly Ser Leu
35 40 4S
Lya Val Gly Aap Arg Leo Leu Sex Val Aap Gly Xle Pro Leu Hie Gly
SO 55 60
Ala Sex sie Ala Ihr Ala Leu Ala Tor Leu Arg Gin Cys Sex His Glu
65 70 75 90
Ala Leu Phe Gin Val Glu Tyr Asp Val Ala 13« Pro
85 90
EU 1537 415 Bl
2.MAR.2009 17=10 NED. OCTROOIBUREAU 43703527580 "NO.077" P.18-
ACCOUNTS
190
<210>108
<211> 102
<212> PRT
<2f3> Homo sapiens
<400>103
Xle Sis Thx Val Ala As» Ala Ser Gly Pro Leu Net Val Glu Xle Val
15 io i$
Ly» Thr Pxo Gly ser Ala Leu Gly lie Sax Leu Th» Thr Thx ser Leu
20 25 30
Arg Aen Lye Ser val Xle Thr lie Asp Arg Xle Lys Pro Ala Gar val
3S 40 '45
Val Asp Arg Ser Gly Ala Leu Hi« Pro Gly Asp Ri» lie Leu ser Xle
50 55 eo
Asp Gly Thr Ser Met Glu Hie eye Ser Leu Leu Glu Ala Thr Lye Leu
65 70 7S eo
Leu Ala Ser lie Ser Giu Lya val Arg Leu Glu lie Leu Pro Val Pro
85 90 95
Gin Sox Gin Arg Pro Leu .
100
<210>1O3
<211s«103
<212?PRT
<213> Homo sapiens
«400>103
Xle Gin Xle Val His Thr Glu Thr Thr Glu Val Val Leu Cye Gly Aep
I 5 10 IS
Pro Leu Sex Gly Phe Gly Leu Gin Leu Gin Gly Gly Xle Phe Ala Thr
20 25 30
Glu Thr Lau Sex Ser Pro Pro Leu Val Cys Phe Xle Glu Pro Aap Ser
35 40 43
Pro Al« Glu Arg Cys Gly Leu Leu Gin Val Gly Asp Arg Val Leu Sex
50 55' 60
IIa Asn Gly Xle Ala Thx Glu Aap Gly Thr Met Glu Glu Ala Asn Gin
«5 70 7S so
Leu Leu Arg Aep Ala Ala Leu Ala Hie Lys Val val Leo Glu Val Glu
85 SO 95
Phe Asp Val Ala Glu. 5er Val
100
<2fQ> 110
<211>103
<2f2>PRT
<213> Homo sapiens
<400> 110
EU 1537 415 Bl
2 MAR.2009 17=10 NED. OCTROOIBUREAU 43703527580
ACCOUNTS
?NO. 077 ? P. 19-
191
lie Gin Phe Asp Val Ala. Glu Ser Val Xla Pro Ser Sex Gly Thr Phe
1 5 10 IS
Hie Val Lys Leu Pre Lya Lys Arg Sex' Val Glu Leu Gly Xle Thr Xle
20 25 30
Ser Sox Ala Sex Arg Lys Arg Gly Glu Pro Leu Xle lie Ser Asp IIa
35 40 45
Lye Lya Gly Ser Val Ale file Axg Thr Gly Thr Lou Glu Pro Gly Asp
SO 55 60
Lys Lee Leu Ala Zle ASp Asn lie Arg Leu Aep Aen Cys Pro Met Glu
65 70 75 80
Asp Ala Val Gin Xle Leu Arg Gin Cya Glu Asp Leu Val Lys Leu Lys
85 90 95
Xle Arg Lya Asp Glu Asp Asn
100
<210> «1
<211>9*
<î212> PRT
«213> Homo sapiens
<4Ö0> 111
Xle Gin Thr Thr Gly Ala Val Ser Tyx thr Val Glu Leu Lys Arg Tyr
15 10 15
Gly Gly Pro Leu Gly Xle Thr Xle Ser Gly Thr Glu Glu Pro Phe Asp
20 25 30
Pro Xla Val Xle Ser Gly Leu Thr Lys Arg Gly Leu Ala Glu Arg Thr
35 40 45
Gly Ala Xle His Val Gly Asp Arg Xla Leu Ale Xle Asn Asn Val Ser
50 55 60
Leu Lyn Gly Arg Pre Leu Ser Glu Ala He His Leu Leu Gin Val Ala
65 70 75 80
Gly Glu Thx Val Thr Leu Lye Xle Lys Lya Gin Leu Asp Arg
83 90
<210>112
<211> 105
<212> PRT
<213> Hörn» sapiens
<*X»112
EU 1537 415 Bl î
2MAR.2009 17=11 NED. OCTROOÏBUREAU 43703527580
ACCOUNTS
'NO.077 ? P.20--------
192
Xla Leu Glu Met Glu Glu Leu Leu Lau Pxo Thr Pro Leu Glu Met Hie
l 5 10 15
Lys Val Thr Leu Hie Lye Asp Pro Met Arg Hie Asp Phe Gly Phe Sex
20 25 30
Val Ser Aap Gly Leu Leu Glu Lya Gly Val Tyr Val Hie Thx Val Arg
35 40 43
Pro Aep Oly Pro Ale Bis Axg Gly Gly Lau Gin Pxo ph« Aap Arg Wal
50 55 eo
Leu Gin Val Asn Bis Val Arg Thr Arg Asp Phe Aap Cye Cye Leu Ala
65 70 75 80
Val Pro Leu Leu Ala Glu Ala Gly Asp Val Leu Glu Leu Xle Xle Sar
85 90 $5
Arg Lys Pro His Thr Ala His Ser Sex
100 10S
<210>11S
<211>ôî
<212>PRT
<213> Homo sapiens
<400>713
Het Ala Leu thr Val Aep Val Ala Gly Pro Ala Pro Trp Gly Phe Arg
1 3 10 IS
Xle Thr Gly Gly Arg Asp Phe His Thx Pro He Mat Val Thr Lye Val
20 25 30
Ala Glu Arg Gly Lys Ala Lys Asp Ala Asp Leu Arg Pro Gly Asp He
3S 40 45
He Val Ala Xla Asn -Gly Glu Ser Ala Glu Gly Met Leu Hie Ala Glu
SO SS 60
Ala Gin Ser Lya Xle Arg Gin ser Pro Ser Pro Lea Arg Leu Gin Leu
65 70 7S 80
Asp Arg Sox Gin Ala Thx Ser Pro Gly Gin Thr
85 90
<210>114
<211>64
<212>PRT
<213> Homo sapjens
<400>114
EU 1537 415 Bl
2MAR.2009 17=11 NED. OCTROOIBUREAU 43703527580
ACCOUNTS
-NO. 077--------P. 21 ?
193
Sex Asn Tyr Sex Val Sex Leu val Gly Pro Ala Pro Trp Gly Phe Arg
IS 16 15
Leu Gin Gly Gly Lys Asp Phe Asn Mot Pro Leu Thx Xlo Ser Ser Leu
20 25 30
Lye Asp Gly Gly Lys Ala Ala Gin Ala Asn Val Arg Xla Gly Aep Val
33 40 45
Vol Leu Sax Xle Asp Gly Ue Asn Ala Gin Gly Met Thx His Leu Glu
SO 55' ? 60
Ala Gin AsH Lye lie Lye Gly Cye Thr Gly Sex Leu Asn Met Thr Leu
65 70 73 80
Gin Arg Ala Sex
<210>115
<211M33
<212> PRT
<213> Homo sapiens
<4ÖO>t15
Thr Leu Val Glu Sis Sex Lys Leu Tyx Cys Gly ais Cye Tyr Tyr Gin
1 S 10 15
Thr Val Val' Thr Pro Vel He Glu Gin Xle Leu Pro Asp Sex Pro Gly
20 23 30
Sox Hie Lou Pro Hia Thx Val Thr Leu Val Ser He Fro Ala Sex Ser
35 40 45
Hie Gly Lya Arg Gly Leu Ser Val Ser He Asp Pro Pro Hie Gly Pro
50 55 60
Pro Gly Cys Gly Ihr Glu Hie Sex Hie Thr Val Arg Val Gin Gly Vel
65 70 75 80
Asp- Pro Gly Cys Met Ser Pre Asp Val Lys Asn Sex Xle Hie val Gly
OS 90 93
Asp Arg Xle Leu Glu He Asn Gly Thx Pro Xle Arg Aen Vol pxo Leu
100 IQS 110
Asp Glu XI« Asp Leu Leu lie Gin Glu Thr Sex Arg Leu Leu Gin Leu
IIS 120 129
Thr Leu Glu His Asp
130
<210>116
<211s-92
<212> PRT
<213> Homo sapiens
<4O0>116
Pro Tyr Ser Val Thr lieu Xle Ser Met Pro Ala Thx Thx Glu Gly Arg
1 S 10 IS
EU 1537 415 Bl
2.MAR.2009 17=11 NED. OCTROOIBUREAU 43703527580 " NO.077" P.22
ACCOUNTS
194
Arg Sly Phe Ser Val Ser Val Glu Ser Ala Cys Ser Asn lyx Ala Thr
20 25 30
Thr Val Gin Val Lys Glu Val Asn Arg »at His Xle Ser Pro Aan Asn
35 40 45
Arg Aaa Ala xle Sis Pxo Gly Asp Arg Ile Leo Glu He Asn Gly Thr
50 SS 60
Pro Val Arg Thr Leu Arg; val Glu Glu Val Glu Aap Ala He Ser Gin
65 70 7S 80
Thr Ser Gin Thr Leu Gin Leu Leu Ha Glu His Aep
85 90 . .
<210> 117
<211>82
<212>PRT
<2is> Homo sapiens
<400> 117
He Kis Ser Val Thr Leu Arg Gly Pro Sex Pro Trp Gly Phe Arg Leu
15 10 15
val Gly Arg Asp Phe Sex Ala Pro Leu Thr He Ser Arg Val Hl» Ala
20 25 30
Gly Sax Lye Ala Sex Leu Ale Ala Leu Cye Pro Gly Asp Leu He Gin
35 40 «S
Ala He Aen Gly Glu Sex Thr Glu Lou Met Thr Mis Leu Glu Ale Gin
SO 55 60
Asn Arg Xle Lyg Gly Cye Hie Aap Hie Leu-Thx Leu Ser Val 3er Arg
63 70 75 80
Pro Glu
<210>118
<211>74
<212> PRT
<213> Homo sapiens
<dQ0>1l8
Val Cya Tyr Arg Thr Aap Aap Glu Glu Asp Leu Gly He Tyr Val Gly
1 . 5 10 15
Glu Val Aaa Pro Aen 9er Xle Ale Ala Lys Aep Gly Arg Xle Arg Glu
20 25 30
Gly Asp Arg Xle He Gin Xle Aen Gly Val Asp Val Gin Aen Arg Glu
35 40 45
Glu Ala Val ALa Xle Leu Sax Gin Glu Glu Asn Thr Asn Ue Sex Leu
50 55 60
Leu Val Ala Arg Pro Glu Ser Gin Leu Ala
65 70
<210>119
<211M03
<212> PRT
<2is> Homo sapiens
<400>119
EU 1537 415 Bl
j 2.MAR.2009 17=12 NED. OCTROOIBUREAU 43703527580 '" " ? ~ NO.077- --P.23-
! ACCOUNTS
195
He Gin Lys Lye Asn Hia <Exa Th*- e*~ » .,*_? ...
t -ar _ 5 xrp Tnx. Ser Arc Val Sia Glu Cye Thx Vol
Lys ftxev Gly Pro Gin Gly Gin Leu ri*, Î?, «. 1S
20 ^ Sy Val T*» V»i Lea ©ly Gly Ala
Glu Hia Gly Glu Phe Pre Tyx Val of« s1 ?^ *°
35 I« *** Wa WL Al» Ala Val Glu Ala
«. g» tm p» Giy «, g, «, Qy ^ ^ ^.^^ -lröa
J. >. i. «. m «« ^ « te, w s« S» ». ». ^ ^
«? va ? Sly jgx a. ^ Sar ^ w Ma ^ ^ ^ »
Ala Val Arg GUa Gly Gly Ar« 9S
100
<210> 120
<2!1> 104
<212> PRT
<213s» Honn? sapiens
<400>120
Pre Ser Gla. Leu Lye Gly Lys Phe Ile His Thr Lys Leu Arg Lye Sex
IS 10 15
Ser Arg Gly Pha Gly She Thr Val Val Gly Gly Asp Glu Pro Asp Glu
20 25 30
Phe Leu Gin He Lye Sax Leu Val Lau Aap Gly Pro Al« Ala Leu Asp
35 40 4S
Gly Lys Hat Glu Thr Gly Asp Val Hö Val Ser Val Aen Asp Thr Cye
50 55 60
Val Leu Gly His Thx His Ala Gin Val Val Lys Xle Phe Gin Sex He
65 70 75 80
Pro He Gly Ala Sex val Asp Leu Glu Leu Cys Arg Gly Tyr pro Leu
SS 90 95"
Pro Phe Asp Pro Asp Asp Pro Asn
«PIA
<21ö> 121
<2T1>S2
<212>PRT
<213> Homo sapiens
<40O> 121
EU 1537 415 Bl
2.MAR.2009 17=12 NED. OCTROOIBUREAU 43703527580 " "NO.077" ?P.24 ?? ?
ACCOUNTS
196
Pro Ale Thr Gin Pro Glu Leu Xle Thr Val His He Val Lye Gly Pro
1.5 10 15
Met Gly phe Gly Phe Thr Xle Ala Aap Ser Pro Gly Gly Gly Gly Gin
20 25 30
Arg val Lys Gin xle Val Asp Bot Pxo Arg Cya Arg Gly Leu Lye Glu
35 40 4S
Gly Aep Leu Xle Val Glu Vel Aan Ly» Lya Abb val Oln Ala Lau Thr
SO 55 60
Hia Asn (Sin Val val Aap Met Leu val Gin Cya Pro Lys Gly Sex Glu
65 70 75 80
Val Tax Leu Leu Val Gin Axg Gly Gly Aan Leu' Ger
BS »"
90
<210:> 122
<211> 102
S212>PRT
<213> Homo sapjens
<4Q0M22
Pro Aap Tyr Gin Glu Gin Aap Xle Phe Leu Trp Arg Lye Glu Thr Gly
i S 10 15
Phe Gly Pho Arg He Leu Gly Gly Aen Glu Pro Gly Glu Pro Xle Tyr
29 25 30
Xle Gly Hie Ue Val Txo Leu Gly Ala Ala Aap Thx Aep Gly Arg Leu
35 40 45
Arg Sex Gly Aap 61a Leu He eye Val Asp Gly Thx Pro val He Gly
SO 55 60
Lys Sex Hie Gin Leu Val Val Gin Leu Met Gin Gin Ala Ala Lye Gin
SS 70 75 80
'Gly Hie Val Asn Leu Thr Val Arg Arg Lya Val Val phe Ala Val Pxo
65 - 90 SS
Lye Thx Glu Aen Sex Ser
<210>123
<211>112
<212>PRT
<213> Hämo sapiens
EUl 537415Bl
2.MAR.2009 17=12 NED. OCTROOIBUREAU 43703527580 ' NO.077--------P.25
ACCOUNTS
197
Gly Val Val Sex Thr Val Val Gin Pxo Tyr Asp Val Glu He Arg Ar«
15 10 15
Gly Glu Aen Glu Gly Phe Gly Phe Val Ho Val Bax Ser Val Sex Arg
20 ZS 30
Pre Glu Ala Gly Thr Ihr Phe Ala Gly Aen Ale Cye Vel Ala Met Pro
35 40 45
HU lye He Gly Axg He He Glu Gly Sex Pro Ala Aap Arg Cye Sly
30 SS 60
tys Leu Lys Val Gly Aap Arg He Leu Ala Val Asn Gly Cye Sar Ile
65 70 75 00
Thx Aan Lye Ser Hia Ser Asp Hs Val Aen Leu Xle Lys Glu Ale Gly
BS 90 35
Asn Thx Val Thr Leu Arg He He Pro Gly Asp Glu Ser Ser Asn Ala
100 105
HO
«21Q> 124
<211>91
<212> PRT
<213> Homo sapiens
*üao>724
Gin Ala Thr Gin Glu Gin Aep Phe Tyr Thr Val Glu Leu Glu Are Gly
1 S 10 - IS
Ala Lya Gly Phe Gly Phe Sex Leo Arg Gly Gly Arg Glu Tyr Aan Met
20 25 30
Asp Leu Tyr Val Leu Arg Leu Ala Glu Aep <?ly Pro Ala Glu Arg Cye
3S 40 '43
Gly Lys Het Arg XXo Gly Aap Glu Xle Leu ôlu Xle Asn Gly Glu Thx
50 55 60
Thr Lys Asn Met hya HU» 9er Arg Ala He Glu Leu Xle Lys Asn Gly
65 70 75 80
Gly Arg Arg Val Arg Leu Pho Leu Lye Arg Gly
S3 30
«21QM25
<2ii>iao
<212> PRT
<213> Korno sapiens
«S00> 125
Pro AI« Lye Met Glu Lys Glu Glu Thr The Arg -Glu Leu Leu Leu Pro
EU 1537 415 Bl
2MAR.2009 17=13 NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.077 - P.2&? -
198
Aan Trp Gin Gly Ser Gly Sex His Gly Lea- Thx He Ala Gin Axg Asp
20 25 30
Aap Gly Val she Val Gin Glu Val Thr Gin Asa Ser Pro Ala Ala Axg
33 40 4S
Thr Gly Val Val Lys Glu Gly Aap Gin Xle Vel Gly Ala Thx Xle Tyr
50 55 SO
Phe Aep Asn Leu Gin Ser Gly Glu Val Thr Gin Leu Leu Aen Thr Met
6S 70 75 80
Gly Hie Bis Thr Val Gly Len Lys Leu Sis Arg Lye Gly Asp Arg Sex
85 SO 95
Pro Asn Sex Sex
IOO
<210> 126
<21?>97
<212>PRT
<213> Hon» sapiens
«400:» 126
Ser Glu Aen Cys Lya Val Phe He Glu Lya Gin Lys Gly Glu He Leu
1 S 10 IS
Gly Val Val Xle Val Glu Ser Gly Trp Gly Sex Xle Les Pro Thr Val
20 25 30
He He Ala Aen Met Met His Gly Gly Pre Ala Glu Lye Ser Gly Lye
35 40 45
Leu Aen He Gly Asp Gin, Xle Mat Ser He Aen Gly Thr Ser Leu Val
SO 55 60
Gly Lau Pro Leu Ser Thx Cye Gin Ser He He Lya Gly Leu Lys Aso
65 70 75 80
Gin Ser Arg Val Lys Leu Aen Xle Val Axg Cya Pro Pro Val Aen Sea?
SS 90 95
Ser
<210> 127
<211>92
<212> PRT
<213> Honr» sapiens
«4Q0>127
Leu Arg Cys Pro Pro Val Thr Thr Val Leu Xle Arg Arg Pro Asp Leu
15 10 IS
Arg Tyr Gin Leu Gly Phe Sor Val Gin Asn Gly Ue Xle Cys 9er Lau
20 25 ' 30
Met Arg Gly Gly Xle Ala Glu Arg Gly Gly Vol Arg vol eiy Hie Arg
35 40 45
Xle He Glu He Asn Gly Gin Ser Val Val Ale Thr Pro Sie Glü Lys
SO SS 60
Xle Val Bis He Leu Sex. Aon Ala Val Gly Glu He His Wer Lys Thr
65 70 75 80
Met Pxo Ala Ala Met Tyr Arg Leu Leo Aan Ser Ser
8S 90
EU 1537 415 Bl
2.MAR.2009 17=13 NED. OCTROOIBUREAU 43703527580 NO.077-------P.27
ACCOUNTS
199
<210>123
<211> ÎOS
<212>PRT
<213> Hon» sapiens
?C40C&128
Leu Sax Aen Ser Asp Aen Cys Arg Glu Val Bis Leu Glu Lys Arg Arg
1 S 10 IS
Gly Glu Gly Leu Sly Val Ala Leu Val Glu Ser Gly Trp Gly Ser Leu
20 25 30
Leu Pro Thr Ala Val Xle Ala Asn Leo Leu Hie Gly Gly Pro Ala Glu
35 40 45
Arg Sax Gly Ala Leu Ser He Gly Asp Arg Leu Thr Ala Ha Aan Gly
SO 55 60
Thr Ser Leu val Gly Leu Pro Leu Ale Ala Cya Gin Ala Ala Val Arg
65 70 7S . 80
Glu Thr Lya Sar Gin Thr Ser Val Thr Lau Ser Xle Vel Hie Cya Pro
65 90 95
Pro Vel Thr Thr Ala Xle Met
100
<210>123
<211> 92
<212>PRT
<213> Homo sapiens
«400>129
Leu Val Hia eye Pro Pxo val Thr Thr Ala Ho He Ria Arg Pro Hie
IS 10 15
Ala Arg Glu Gin Leu Gly Phe Cya Val Glu Aap Gly He He Cys Sex
20 25 30
Leu Leu Arg Gly Gly Xle Ala Glu Arg Gly Gly Xle Arg Val Gly Hie
35 40 45
Arg He He Glu He Asn Gly Gin Sex Val Vel Ala Thx Pxo Bis Ala
SO 55 60
Arg He Xle Glu Leu Leu Thr Glu Ala Tyr Gly Glu Vol Mis He 1^9
65 70 75 80
Thr Met Pro Ala Ala Thx Tyr Arg Leu Leu Thr Gly
as
<2f0>130
<211>86
<212>PRT
<213> Homo sapiens
<4GQ>t3Q
EUl 537415Bl
2MAR.2009 17=13 NED. OCTROOIBUREAU 43703527580
ACCOUNTS
--NO. 077--------P.28---------
200
Arg Lys Val Arg Leu He Gin Ehe Glu Lys val Thr Glu Glu Pro Met
i S 10 15
Gly Xlo Thr Lan Lys Leu Aan Glu Lya Gin Sex eye Thr val Ala Arg
,20 ' 25 30
He Leu Hie Gly Gly Met Xle Hie Arg Gin Gly Ser Leu His Val Gly
35 40 45 .
Asp Glu Xle Leu Glu Xle Aen Gly Thr Aen Val Thr Aen Kis sex Val
50 '35 60
Aap Gin Leu Gin Lys Ale Met Lys Glu Thr Lys Gly Met Xle Sex Leu
65 70 7$ 60
Lys Val Xle Pro Asn Gin
SS
<210> 131
<211»59
<212>PRT
<213p> Homo sapiens
«400>131
Pro Val Pro Pro Asp Ala Val Arg Het Val Gly He Arg Lys Thx Ala
15 10 IS
Sly Glu Bis Leu Gly Val Thx Phe Arg val Glu Gly Gly Glu Leu Val
20 28 30
He Ala Arg He Leu Hie Gly Gly Biet Val Ala Gin Gin Gly Leu Leu
35 40 45
Bis Val Gly Asp He Xle Lye Glu val Aan Gly Gin Pro val Gly Sex
50 55 60
Asp Pro Arg- Ala Leu Gin Glu Leu Lau Arg Asn Ale Ser Gly Sex Val
6S 70 7S 60
xle Leu Lys Xle Lau Pro Aen Tyr Gin
8S
<210> 132
<211>99
<212>PRT
<212> Homo sapiens
<400>1S2
Gin Gly Arg Hia Val Glu Val Pho Glu Leu Leu Ly» Pro Pxo Ser Gly
15 10 15
Gly Leu Gly Phe Sex Val Val sly Leu Arg Sex Glu Asn Arg Gly Glu
20 25 30
Leu Gly He Phe Vol Gin' Glu Xle Gin Glu Gly Ser Val Ala Hie Arg '
35 40 45 l'
Asp Cly Arg Lev. Lye Glu Thx Asp Sie He Leu Ala He Asn Gly Gin '
SO SS 60 i'
Ale Leu Asp Gla fht He Thr His Gin Gin Ale Ue Sex Xle Leu Gin i
65 70 75 60 I
Lya Ala Lys Asp Thr Val Gin Leu Val He Ale Arg Gly Ser Leu Pro |
95 90 S3 l
Glö Leu Val j
EU 1537 415 Bl
2.MAR.2009 17=14 NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO. 077 P. 29"
201
<210>?33
<211>37
<212> PRT
<213> Homo sapiens
«tQQ> 133
Pro Val His Trp Gin His Hat Glu Thr Xle Glu Leu Vel Asn Aep Gly
2 5 10 13
Ser Gly Leu Gly Phe Gly Xle Xle Gly Gly Lye Al« Thx Gly Val Xle
20 25 30
Val Lya Thx He Leu Pro Gly Gly Val Ala Asp Gin Bis Gly Arg Leu
35 40 45
Cys Bex Gly Asp His Xle ton lya He Sly Asp Thr Aop Lou Ala Gly
50 55 60
Met Ser Ser Glu Gin Vel Ala Gin Val Leu Arg Gin Cys Gly Asn Arg
6S 70 75 00
Val Lys Leu Het He Ale Arg Gly Ala He Glu Glu Axg Thx Ala Pro
65 90 95
Thr
<210> 134
<211>98
<212> PRT
<213> Memo sapiens
<40Q> 134
Gin Glu Ser Glu Thr Phe Asp Vel Glu Leu Thx Lye Aaa val «in Gly
1 S 10 IS
Leu Gly Xle Tax He Ale Gly Tyr He Gly Asp Ly« Lye Leu Glu. Pro
20 25 30
Ser Gly Xle Phe Val Lys Ser Xle Thx Lys Ser Ser Ale Val Glu Sie
35 «0 45
Asp Gly Arg Xle Gin Ile Gly Aap Gin Xle He Ala Val Asp Gly Mir
50 55 .60
Aon Leu Gin Gly a» Thr Aan -Gin sin Ala val oiu val Lea Ara sie
ÖS 70 73 SO
Thx Gly ©in Thx Val Leu Leu Thr Leu Met Arg Arg ßly Mat Lyn Oln
65 90 95
Glu Ala
«Z1Q>135
<2»1>92
<212>PRT
<213;> Homo sapiens
«4Q8>135
EU 1537 415 Bl
2.MAR.2009 17=14 NED. OCTROOIBUREAU 43703527580 "0.077 >.36T
ACCOUNTS
202
Leu Asn Tyr Glu Xle Val Val Ale Hie Val Ser Lys Phe Ser Glu Asn
15 10 15
Ser Gly Leu Gly He Ser Leu Glu Ala Thr Val Gly Hie His Phe Xle
20 25 30
Arg Ser Val Leu Pro Glu Gly Pro Vol Gly Hia Ser Gly Lys Lau Phe
3S 40 45
Ser Gly Asp Glu Leu Leu Glu Val'Ase Gly Ue Thr Leu Leu Gly Giu
50 55 60
A«n Hie Ola Asp Val Val Asn Xle Leu Lys Glu Lau Pro Xle Glu Val
S5 70 73 68 .
Thr Met val eye Cys Arg Arg Thr Val Pro Pro Thx
85 90
<210> 136
<211> 100
<212>PRT
<213> Homo sapiens
<40O>136
Trp Glu Ala Gly Xle Gin Hia Xle SZu Leu Glu Lya Gly Ser Lya Gly
1 S 10 15
Leu Gly Phe "Bar He Leu Aap Tyx Gin Asp Pro IIa Asp Zxo Ala Ger
20 25 . 30
Thr Val Xle He Xle Arg 8er Leu Val Pro Gly Gly Xle Ala Glu Lys
35 40 45
Aap Gly Axg Leu Leu Pro Gly Aap Arg Leu Mat Phe Val Asn Asp Val
SO 55 £0
Asn Leu Glu Asn Ser Ser Leu Glu Glu Ala Val Glu Ala Leu Lyo Gly
65 70 75 SD
Ala Pro Sex Gly Thx Val Axg Xle Gly Val Ala Lya Pro Leu Pro Lau
8S go 95
Ser Pxo Glu Glu
1O0 .
<210> 137
<211>99
<212>PRT
<213> Homo sapiens
«40Ö>137
EU 1537 415 Bl
2 MAR.2009 17=23 NED. OCTROOIBUREAU 43703527580
ACCOUNTS
-NO. 078------P-2-------
203
Arg Asn Val Sar Lys Glu Ser Pho Glu Arg Thr He Asn He Ala Lya
15 10 IS
Gly Asn Ser Ser Leu Gly Met Tbr Vel Ser Ala Asn Lye Asp Gly Leu
20 23 30
Gly Met xie Val Arg Ser He Xle His Gly Gly Ala Xle Ser Arg Aap
3$ 40 45
Gly Axg He Ala xle Gly Asp Cys Xlo Leu Sex Xle Asn Glu Glu Ser
SO 55 «0
Thr He Sex Val Thr Asn Ala Gin Ala Arg Ala Ket Leu Axg Arg Hia
65-70 75 B0
Ser Leu Xle Gly Pro Aap He Lys He Thr Tyx Val Pro Ala Glu Hia
95 90 95
Leu Glu Glu
<210>138
<2<1>-J12
<212>PRT
<213> Horno sapiens
<tfOÖ>138
Leu Asn Trp Asn Gin Pro Arg Arg Val GIU Leu Trp Arg Glu Pxo Ser
IS 10 15
Lya Ser Leu Gly Xla Ser Xle Val Gly Gly Arg Gly Mot Gly Sex Arg
20 25 30
Lau Ser Asn Gly Glu Val Mat Arg Gly He Phe Xle Lys Hia Val Leu
35 40 4S
Glu Aap Ser Pro Ala Gly Lye Aso Gly Thr Leu Lys Pro Gly Asp Arg
50 SS 60
He Val Glu Val Aep Gly Met Aap Leu Arg Aap Ala Sex Hia Glu Gin
65 70 75 B0
AU Val Glu Ala He Arg Lys Ala Gly Asn Pro val Val Phe Met Val
85 90 95
Gin Ser Xle Xle Asn Arg Pxo Arg Lys Ser Pre Leu Pro Sex Leu Lau
100 105 110
«210 139
<?11>S5
<212>PRT
<213> Hoitkt sapiens
«MO» 133
Leu Thr Gly Glu Leu Hie Met Xle Glu Leu Glu Lys Gly Bis Ser Gly
1 5 10 15
Lau Gly Leo Ser Leu Ala Gly Asn Lys Aap Arg Sar Arg. Met sex Val
20 25 30
Phe He Val Gly Xle Asp Pxo Asn Gly Ala Ala Gly Lya Asp Gly Arg
33 40 43
Leu Gin Xla Ale Asp Glu Leu Leu Glu He Aan Gly Gin He Leu ïyr
SO 55 60
Gly Arg Ser Hie Gin Aen Ala der 5er He Ho Lys Cye Ala Pro Sex
65 70 75 80
Lya Val Lys He Xle Phe Xle Arg Aen Lys Aap Ala Val Asn Gin
85 90 95
EUl 537415Bl
2 MAR.2009 17=23 NED. OCTROOÏBUREAU 43703527580
ACCOUNTS
?? - -NO.07& ?P.3 ?
204
«2Î0>14Q
<212*PRT
?öi3> Hon» sapiens
<40Û>140
Leu Sex Sar Phe Lys Aso Vâl Gin Hie Leu Glu Leu Pro Lye Asp Glu
1 5 10 15
Gly Gly Leu Gly Ho Ale He Ser Glu Glu Asp Thx Leu Ser Gly Vol
20 23-30
He He Lys Ser Leu Thx Glu Hie Gly Vsl Ale Ale Thr Asp Gly Arg
35 40 45
Leu Lys Val Gly Asp Gin He Leu Ala Val Aap Asp Glu Xle Val Val
50 55 60
Gly tyr pro He Glu Lye Phe Xla sax Leu Lau Lys Thr Ala Lya Met
65 70 75 80
Thr Val Lye Leu Thr Xle Hie Ale Glu Asn Pro Aap 3ax Sin
BS 90
<210> 141
?*21T>S5
<212* PRT
<2i3> Homo sapiens
<400> 141
Leu Pro Gly Cys Glu Thr thr Xla Glu He Ser Lys Gly Arg Thr Gly
1 S 10 . 15
Lbu Gly Lau Sex Xla Val Gly Gly Ser Asp Thx Lets Leu Gly Ala Xle
20 25 30
Ha Ue Hia Giu Val Tyr Glu Glu Gly Ala Ale Cye Lys Asp Gly Arg
35 40 45
Leu Trp Ala Gly Asp Glu He Leu Glu Val Asn Gly He Aep Leu Axg
50 55 60
Lys Ala Thr Bis Asp Glu Ala Xle Aen Val Leu Arg Gin Thr Pro Gin
es 70 73 eo
Arg Val Arg Leu Thx Lau Tyr Arg Aap Glu Als Pxo Tyr Lya Glu
85 90 93
<210>142
«21T>98
<212>PRT
<213> Homo sapiens
<4C0>*42
EU 1537 415 Bl
2 MAR.2009 17=23 NED. OCTROOIBUREAU 43703527580
ACCOUNTS
-------NO.078- -P-4-
205
Lys Glu Glu Glu Val Cys Asp Thr Leu Thx Xle Glu Leu Gin Lys Lys
1 5 10 15
Pro Gly Lys Gly Leu Gly Leu Ser He Val Gly Lys Arg Asn Asp Thr
20 25 30
Gly Val Phe Val Ser Aep Ue Val Lye Gly Gly He Ala Aap Ala Aap
35 40 45
Gly Arg Leu Met Gin Gly Aep Gin He Leu Met Val Asn Gly Glu Asp
50 55 60
Val Arg Aen Ala Thr Gin Glu Ala Val Ale Ala Leu Leu Lys eye Sex
65 70 75 80
Leu Gly Thr Val Thr Lau Glu Val Gly Arg Ha .Lys Ale Gly Pro Phe
85 90 95
Bis Ser
<310>143
<2Ï1>96
<212»PRT
<2f 3> Homo sapiens
c400>143
Leu Gin Gly Leu Arg Thr Val Glu Mot Lys Lys Gly Pro Thx Aap Sex
15 10 15
Leu Gly Ho Ser He Ala Gly Gly Val Gly 8ex Pro Leu Gay Aap Val
20 25 30
Pro Xle Pho He Ala Met Met His Pre Thr Gly Val Ala Ala Gin Thr
35 40 45
Gin Lye Leu Arg: Val Gly Aap Arg Xle Vel Thr He Cye Gly Thr Ser
50 35 ?0
Thr slo Gly Met Thx Bis Thr Gin Ale Val Asn Len Leu Lye Asn Ala
65 70 75 80
Sax Gly Ser He Glu Met Glu Val Val Ala Gly Gly Asp Val Sex Val
85 90 95
<210>144
<211>91
<212>PRT
<2?&>- Homo sapiens
<400>iü
Lau Gly Pro Pro Gin Cye Lys Ser He Thr Leu Glu Axg Gly Pro Asp
15 10 15
Gly Leu Gly Phe Ser Xle Val Gly Gly Tyr Gly Sex Pro flia Gly Aap
20 25 30
Leu Pro Xle Tyr Val Lye Thr val Ph« Ala Lya Gly Ala Ala Ser Glu
35 40 45
Aap Gly Arg Leu' Lys Arg Gly Asp Gin He He Ala Val Asn Gly Gin
, 50 55 60
Ser Leu Glu Gly Val Thx His Glu Glu Ala Val Ala Xle Leu Lys Axg
65 70 75 SO
Thr Lys Gly Thx Val Thr Leu Met Vol Leu Ser
85 90
<210> 145
<211>S3
<2T2>PRT
EU 1537 415 Bl
2MAR.2009 17=24 NED. OCTROOIBUREAU 43703527580
ACCOUNTS
? ?NO. 078- -P. 5 -
206
<2l3s> Homo sapiens
«400*145
He Gin Tyr Glu Glu He val Leu Glu Arg Giy Asa ser Gly Leo Gay
15 10 15
Phe Sex Xle Ala ©ly Gly Xla Aap Ase Pro ale Val Pro Asp Asp Pro
20 25 30
Gly Xle Phe Xle Thr Lys Xle He Pro Gly Gly Ala Ala Ala Mar Aep
35 40 45
Gly Arg Leu Gly Val Aan Asp Cys Val Leu Arg Val Aan Glu Val Glu
50 55 60
val Ser Glu Val Val Hie Ser Arg Al« val Glu Ala Leu Lys Glu Ala
65 70 75 80
Gly Pro Val Val Arg Leu val Val Arg Arg Arg Gin Ase
85 90
<210> 146
<211>90
*212>PKT
<213> Hou» s^pfens
«400?-145
Xle Thr Leu Leu Lys Gly Pro Lys Gly Leu Gly Ph« Ser Ho Aie Gly
1 5 10 IS
Gly He Gly Asn Gla His He Pre Gly Asp Asn Ser He Tyr He Thr
20 25 30
Lys Xla He Glu Gly Gly Ala Ala Gin Lys Asp Gly Arg Leu Gin Xle
33 40 «S
Gly Aap Arg Leu Leu Ale Val Aan Asa Thr Aen Leo Gin Aap Vel Arg
SO 55 60
His ölu Glu Als Val Ala 8er Lau Lya Asn Thr Sex Asp Met Val Tyr
65 70 75 80
Lau Ly» Val Ala Lya Pro Gly Sex Leu Gin
85 90
<210? 147
<211>119
<272>PRT
<213> Homo sanJens
<400>147
EU 1537 415 Bl
I
2 MAR.2009 17=24 NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO. 078 --P.6------
207
He Lou Leu Hie Lys Gly Sex Thx Gly leu Gly Phe Asn Xla Val Gly
15 10 IS
Gly Glu Asp Gly Ole Gly Xle Phe Val gar Phe He Leu Ala Gly Cly
20 33 30
Pro Ala Asp Leu Ser Gly Qlu Leu Arg Arg Gly Asp Arg He Leu Sar
35 40 45.
val Asn Gly Val Asn Leu Arg Asn Ala Tbr His Glu Gin Ala Ala Ala
SO 55 60
Ala Leu Lys Arg Ala Gly Gin sex Val Thr He val Ala Gin Tyr Arg
65 70 75 90
Pro Qlu Glu Tyr Ser Arg Phe Glu Ser Lys XXe sis Asp Leu Arg ©la
85 »0 95
Gin Msfc Mee Aan Bar âer Mee sex Sex Gly Sex Gly Ser Leu Arg Thr
100 105 110
Sax Glu Lya Arg Sex Leu Glu
HS
<210>148
c21f*111
<212> PRT
<213> Honro sapiens
<400>143
Cys Val Glu Arg Leu Glu Lau Phe Pro Val Glu Leu Glu Lye Aep Ser
15 10 15
Glu Gly Leu Gly He Sex He Xle Gly Met Gly Ale Gly Ale Asp Met
20 25 30
Gly Xieu Glu Lyd Lau Gly He Phe Val Lys Thr Val Thr Glu Gly Gly
35 40 45
Ala Ala Hls Arg Aap Gly Arg He Gin val Asn Asp Leu Leu Val Glu
50 55 60
Val Asp Gly Thr Sex Leu Vol Gly Val Thr Gin Ser Pho Ala Ala Sax
65 70 75 80
Val Leu Arg Asn Thx Lys Gly Arg Val Arg Ph« Met He Gly Arg Glu
85 90 95
Arg Pro Gly Glu Gin Sex Glu Val Ala Gin Arg Xle Bis Arg Asp
100 105 HO
<210> 149
<zii>sa
<212>PRT
<213> Homo sapiens
<4O0> 143
EU 1537 415 Bl
2 MAR.2009 17=24 NED. OCTROOIBUREAU 43703527580
ACCOUNTS
? ? NO.078 ? P.7 -
208
He Gin Pro Asa val He Ser Val Arg Leu Phe Lye Arg Lya Val Gly
15 10 15
Gly Lett Gly Phe Lau Val Lys Glu Arg Val Ser Lys Pro Pro Val He
20 25 30
He Sex Asp Leu He Arg Gly Gly Ala Ale Glu Gin Ser Gly Leu He
35 40 43
Gin Alu Gly Aap He He Leu Ala Val Asn Gly Arg Pro Leu Val Asp
30 55 60
Leu Ser Tyr Aq» Ser Ala Leu Glu Val Lau Arg Gly He Ala Ser Glu
65 70 7S 80
Thr Bis Vol Val Leu Xle Leu Arg Gly Pro
85 90
<210>150
<211> 107
<212>PRT
<213> Homo spiers
<4GQ> 150
Gin Ala Ase Sex Asp Glu Sor Aap Xle He Hia Sex Val Arg Val Glu
15 10 13
Lya Sar Pxo ALa Gly Arg Lau Gly Phe Ser Val Arg Gly Gly Sax Giu
50 25 30
Hie Gly Leu Gly He Phe Val Ser Lys Val Glu Glu Gly Sex Ser Ala
35 40 45
Glu Arg Ala Gly Leu Cye Val Gly Aap Lys He Thr Glu Val Aen Gly
50 55 60
Lau Sar Leu Glu > Sex Thr Thx Met Gly 3«r Ala Val Lys Val Lau Thx
65 70 73 60
Ser Sex Ser Arg Lea Hia Met Mat Vol Arg Arg Mat Gly Arg Val Pro
35 90 95
Gly Xle Lys Phe Ser Lye Glju Lys Asn Sor Ser
100 105
<210> 151
<211>106
<212>PRT
<21S> Homo s^tens
<4DO 151
Pro Sax Asp Thx Ser Ser Glu Aep Oly Val Arg Arg He Val Sis Leu
1 5 10 .IS
Tyr Thr Thr Ser Aep asp she Cye Leu Gly ehe Asn Xle Arg Gly Gly
20 25 30
Lya Glu Phe Gly Leu Gly H« Tyr Vel 3er Lys Val Aap His Gly Gly
35 40 45
Leu Ale Glu Glu Asn Gly He Lys Val Gly Aap Gla Val Leu Ale Ala
SO 55 eo
Asn Gly Val Arg Phe Aep Asp He Sar Kis Sar Gin Ala Val Glu Val
65 70 7$ so
Lou Lye Gly Sin Thr His He Mat Leu Thr Xla Lys Glu Thr Gly Arg
83 90 95
EU 1537 415 Bl
2 MAR.2009 17=25 NED. OCTROOIBUREAU 43703527580
ACCOUNTS
? - NO.078 ? P.8 - .. --------
209
Tyr Fro Ala Tyr Lya Glu Mat Aen Ser Ser
IOO 105
<210>152
<211>115
<212>PRT
<213> Homo sapiens
<s4D0>182
ly* Xle Lyd Lys Phe Leu Thx Glu Sor Bis Aap Arg Gin Ala Lys Gly
15 10 15
Lye Ala Xle Thx Lys Lys Lya Tyr He Gly Xle Arg Hat Met Sex Leu
20 25 30
Thr Sex Sex Lya Ala Lys Glu Leu Lye Asp Arg Bis Arg Asp Phe Pro
35 40 45
Aap Vel He Sex Gly Ala Tyr He Xle Glu Val Xle Pro Asp Ihr Pro
SO 55 60
Ale Glu Ala Gly Gly Leu X&a Glu Aen Asp Val He Xle Sex Xle Asn
«5 70 75 90
Gly Gla Sex Val Val ser Ala Asn Aap Val Ser Aap Val Xle Lys Arg
85 90 95
Glu 3er Thr Leu Aen Met Val Val Arg Arg Gly Asn Glu Asp He Met
100 105 110
Xla Thx Val
HS
«210> 163
<211>100
<212> PRT
<213> Homo saptens
«4Ö0M53
Pro Asp Gly Glu Xle Thr Sex Ue Lya He Aen Arg Val Aep Pro Ser
15 10 15
Glu Ser Leu Sex Xle Arg Leu Val Gly Gly Sex Glu Thr Pro Leu Val
20 25 30
His Xle He Xle Gin Hie He Tyr Axg Aap Gly Val Xla Ale Arg: Aap
35 40 45
Gly Ar« Leu Leu Pro Gly Aap Xle He Leu Lye Val Asn Gly Met Aap
50 35 60
He Sex Asn Val Pro Hie Aan Tyr Ala Val Arg Leu Leu Arg Gin Pro
65 70 75 80
Cys Gla Val Leu Trp Leu Thr Val. Met Arg Glu Gin Lys Phe Arg Sex
85 90 35
Arg Asn Ser Ser
. 100
<210>1S3
<2t1> 1Ö1
*212>PRT
<213> Homo sapiens
EUl 537415Bl
2 MAR.2009 17=25 NED. OCTROOIBUREAU 43703527580
ACCOUNTS
?NO. 078------P.9 ?
210
<4O0> 154
Hie Arg Pre Arg Asp Asp Ser Phe His Val Xle Leu Asn Lys Ser ser
i, S 10 13
Pro Glu Glu Gin Leu Gly Xle Lys Leu val Arg Lys Vel Aap Ole Pro
20 25 30
Gly Vel Phe Ile Phe Asn Val Leu Asp Gly Gly Vol Ale Tyr Arg His
35 «0 45
ôiy Gin Leu Glu Glu Asn Aap Arg val Leu Ala Xle Asn Gly Hia Asp
50 55 60
Leu Äcg Tyr Gly Sex Pro- Glu Ser Ala Ala Hls Leu He Gin Ala Ser
65 70 75 80
Glu Arg Arg; Val Bis Leu Vel Val Ser Arg Gin val Arg ein Arg Ser
65 90 93
Pro Glu Aan Ser ser
100
<21D>155
<211>104
<212> PRT
<213> Homo sapfens
?oiDG> 155
Pro Thr He Thx Cys Bis Glu Lys Val val Asn lie Gin Lys Asp Pro
1 5 10 is
Gly Glu Sex Leu Gly Met Thr Val Ala Gly Gly Ala Sex Ris Ars Glu
20 25 30
Trp Aap Leu Pro He Tyr Val He Sar Val Glu Pro Gly Gly val xle
35 40 45
Sex Arg Aap Gly Arg Ue Lys Thx Gly Aap He Leu Leu Ase Vel Aap
50 5S 60
Gly Val Glu Leu Thx Glu Val Sex Arg Sar Glu Ala Val Ala Leu Leu
£5 70 75 eo
Lya Arg Thr Sex Sex Ser Xle Val Leo Lys Ale Leu Glu Val Lys Glu
85 90 95
Tyr Glu Pro Gin Glu Phe Xle Val
100
<2ll>99
<212>PRT
<213> Hcsno sapiens
«40Q>156
EU 1537 415 Bl
2.MAR.2009 17=25 NED. OCTROOIBUREAU 43703527580 ? ~NO.078? -P.10-
ACCOUNTS
211
Pro Arg Cya Leu Tyr Asn Cys Lys Aap Xle Val Leu Axg Arg Asn Thr
1-5 XO 19
Ala Gly Ser Leu Sly Phe Cys Xle Val Gly Gly Tyr Glu Glu Tyr Asn
20 25 30
61y Asn Lys Pro Phe Phe He Lye Ser Xle Val Glu Gly Thr Pro Ale
35 40 45
Tyr Asn Asp Gly Arg Xlo Arg Cya Gly Asp Xle Leu Leu Ala Val Asn
50 55 60
cly Arg Sex Thr sex Gly Met Xle His Ala cys Leu Ale Axg Leu Leu
65 70 75 80
Lys Glu Leu Lye Sly Arg Xle Tbr Leu Thr He Val Sex Trp Pro Gly
85 90 95
Thr Phe l*u
<2TD>157
<21H>101
<2122» PRT
<213> Homo sapiens
<400>157
Leu Leu Thx Glu Glu Glu tins »-.. ? '
x ga« «u Xlo Asn Leu Thr Arg Gly Pro See Gly Leu
10 ? IS"
Gly Phe Asn Xle Val Gly Gly Thr Aap Gin Gin Tyr Val Sex Aan Aap
20 23 30
Ser Gly Ue Tyr Val Ser Arg Xle Lys Glu Asn Gly Ala Ala Ala Leu
35 40 45
Asp Gly Arg Leu Gin Glu Gly Aap Lya He Leu Ser Val Aen Gly Gin
50 SS 60
Asp Leu Lys ASn Leu Leu His Gin Aap Ala Val Aap Leu Phe Arg Asn
65 70 75 SO
Ala Gly Tyr Ala Val Ser Leu Arg Val Gin His Arg Leu Gin Val Gin
85 80 95
Asn Gly He Sis Sex
100
<210>158
<211>94
<212> PRT
<2X3> Homo sapiens
«J00>158
EU 1537 415 Bl
2.MAR.2009 17=26 NED. OCTROOIBUREAU 43703527580
ACCOUNTS
? "NO.078-------P. 11
212
Pro Val Asp Ala Xle Arg He Leu Gly He His Lys Axg Ala Gly Glu
1 S 10 15
Pro Leu Gly Vel Thr Phe Arg Val Glu as& Asn Asp Leu Val Ue Ala
20 25 30
Arg He Leu His Sly Gly Mat Xle Asp Arg Gin Gly Leu Leu His Val
35 AO 45
Gly Asp He Uo Lys Glu Val Asn Gly His Glu Val Gly Asn Aen Pro
50 SS 60
Lya Glu Leu Gin Glu Lou Leu Lys Aen Ue Ser Gly Sex val Thr Leu
65 70 75 80
Lya xla Leu Pro Sex Tyr Arg Asp Thx He Thr Pro Gin Gin
85 90
<213>159
<211>93
<?12> PKT
<213* Homa sapiens
<40Ö>159
Aep Asp Kat val Lya Leu Val Glu Va] Pro Aan Asp Gly Gly Pro Leo
IS 10 15
Gly He Bis Val Val Pro Phe Ses Ala Arg Gly Gly Org Thr Leu Gly
20 SS 30
Leu Leu Val Lys Arg Leu Glu Lys. Gly Gly Lys Ala Glu His Glu Asn
35 40 45
Leu Phe Acg Glu Aan Aep Cys He Val Axg Xle Ass Asp Gly Asp Leu
50 55 60
Arg Asn Arg Arg Phe Glu Gin Ala Gin His Met Phe Arg Gin Ala Met
?S 70 75 80
Arg Thr Pro lie He Trp Pha sie Val val Pro Ale Ala
35 90
<2ia> ißo
<2I1>34
<212> PRT
<213> Hoar» sapiens
«MW>150
Gly Lye Arg Leu Aen He Gin Leu Lya Lya Gly Thr Glu Gly Leu Gly
1 ' 5 10 15
Phe Ser Ue Thx Ser Are; Asp Val Thr Xle Gly Gly sex Ala Pro Ue
20 25 30
Tyr Val Lya Asn He Leu Pro Arg Gly Ala Ala He Gin Asp Gly Arg
35 40 45
Leu Lys Ale Gly Asp Arg Leu He Glu Vol Asn Gly Val Asp Leu val
50 55 60
Gly Lys Ser Gin Glu Glu val Vol Ser Leu Leu Arg Ser Thx Lys Met
65 70 73 90
Glu Gly Thr Val Sax Leu Leu Val Phe Arg Gin GlU Asp Ala
85 JO
<2.Q> 161
EU 1537 415 Bl
2.MAR.2009 17=26 NED. OCTROOIBUREAU 43703527580 '~NO.078? -P.12
ACCOUNTS
213
<211M03
<212>PRT
<213> Htoma sapiens
<40O161
Thr Pro Asp Gly Thx Arg Glu Phe Leu Thr Phe Glu Val Pre Leu Aen
15 10 15
Asp Ser Gly Ser Ala Gly Leu Gly vel Ser Val Lys Gly Asn Arg Sex
20 25 3Q
Lys Glu Asn His Ala Asp Leu Gly xle Phe Val Lya Ser Xle Ue Aen
35 40 43
Gly Gly Ale Ala Sex Lys Aap Gly Arg Leu Axg Val Aen Asp Gin Leu
SO 55 60
XI« Als Val Asn Gly Glu S«x Leu Lau, Gly Lya Thr Asn Gin Asp Ale
65 70 75 SO
Met Glu Thr Leu Arg Axg Sor Met Sex Thr Glu Gly Asn Lys Arg Gly
85 30 95
Met Xle Gin Leu Xle Val Ala
100
<21D> 162
<211> JQ2
<2T2> PRT
<213> Homo s^Sens
<40O> 162
Leu Pro Glu Thx Hls Arg Arg Val Arg Leu &ls Lye His Gly Sex Aap
13 10 15
Arg Pro Leu Gly Phe Tyr Xle Arg Aap Gly Met Ser Val Arg Val' Ala
20 23 30
Pro Gin Gly Leu Glu Arg Val Pro Gly Ile Phe Xle Ser Arg Leu Val
35 40 45
Arg Gly Gly Leu Ala Glu Sex Thr Gly Leu Leu Ala Val ser Asp Glu
50 59 60
Ue Leu Glu Val Asn Gly Ue Glu Val Ala Gly Lya Thr Leu Asp Gin
65 .70 75 60
Val Thr Asp Net Met Val Ala Asn Ser Sie Asn Leu Xle Val Thr Val
85 90 95
Lys Pro Ala Asn Gin Arg "
100
<2*0> »S3
<211>111
<212> PRT
<2ï3> Homo sapiens
<40ß> 163
EU 1537 415 Bl
2MAR.2009 17=26 NED. OCTROOIBUREAU 43703527580 -*>?"*-
ACCOUNTS
214
He Asp Val Asp Leu Vol pxo Glu Thr Hie Arg Arg Val Arg Leu Bis
15 10 15
Arg His Gly Cys Glu Lys Pro Leu Gly Phe Tyr Xle Arg Aq» Gly Ala
20 25 30
Sex Val Arg Val Ihr Pro ui* Gly Leu Glu Lye Val Pro Gly H.e Phe
35 40 45
Xle Ser Arg Het Vel Pro oly Gly Leu Ala Glu Sex Thx Gly Leu Lau
SO 55 fio
Ala Val Asn Aap Glu Val Leu Glu Val Asa Gly Ue Glu Val Ala Gly
6S 70 75 . < 80 ?
Lys Thr Leu Asp Gin Vel Thr Asp Met Met Xle Ale Asn Ser Kle Aon
85 90 95
Leu He Val ihr Val Lya Pro Ale Aan Gin Arg Asn Asn Val Val
100 105 110
<210>1S4
«211M00
<212> PRT
<213> Homo sapfeBS
«400>164
Arg Sex Arg Lye Leu Lys Glu Val Arg Leu Asp Arg Leu His Pro Glu
1 5 10 IS
Gly Leu Gly Leu Ser Val Arg Gly Gly Leu Glu Phe Gly cya Gly Leu
20 29 30
Phe xle Sex Hie Leu Xle Lys Gly Gly Gin Ala Asp Ser Val Gly Leu
35 40 45
Gin Val Gly Asp Gla Xle Val Arg Ue Asn Gly Tyr Ser Xle Sex Sex
SO 55 60
Cya Thr Mis Glu Glu Val He Asn Leu Xle Axg Thr Lys Lys Thr Vel
? 65 70 75 80
Ser XI» Lys val Arg Hls He Gly Leu Ue Pro val Lys Ser Sex Pro
85 SO 95
Asp Glu Phe Hia
100
<2*0> 165
<2î1> 102
<212> PRT
<213> Homo sapiens
<4D0>1S5
EU 1537 415 Bl
2 MAR.2009 17=27 NED. OCTROOIBUREAU 43703527580
ACCOUNTS
?"NO. 078"? P.14-
215
Ue Pro Gly Asn Arg Glu Aen Lye Giu Lya Lye Val Phe xle ser Leu
l 5 10 15
Val Gly Sex Arg Gly Leu Gly Cys Sex He Sex Ser Gly Pro He Gin
20 25 30
Lya Pro Gly Xle Phe He ter Sis Val lya Pro Gly Sex Leu Ser Ala
35 40 45
Glu Val Gly Lau Glu Xle Gly Aap Gin Xle Val Glu Val Aan Gly Val
50 55 eo
Aap Phe Ser Asn Leu Aep Hi» Lye Glu Ala Val Aan val Leu Lys Sor
SS 70 75 80
Sar Arg Sex Leu Tbr He Ser Xle Val Ala Ala Ala Gly Arg Glu Lou
65 90 95
Phe Met Thr Asp Glu She
100
<210> 156
<211>103
<212>PRT
«213> Homo sapiens
c*JO0>16S
Pro Glu Gin He Met Gly Lys Asp Val Arg Leu Leu Arg Xle Lya Lya
15 10 15
Glu Gly Sex Leu Aap Leu Ala Leu Glu Gly Gly Val Aap Sex Pro He
20 25 30
Gly Lye Val Val Val Sex Ala Val Tyr Glu Arg Gly Ala Ala Glu Arg
35 (0 45
His Gly Gly He Val Lys Gly Asp Glu Xle Met Ala He Asn Gly Lys
50 55 60
Xle Val Thr Asp Tyr Thr Leu Ala Glu Ale Asp Ala Ala Leu Gin Lys
65 70 75 60
Ale Trp Aan Gin Gly Gly Aap Trp He Asp Leu val val Ale Val cys
. 85 90 95
Pro Pro Lys Glu Tyr Aap Aap
100
<2io> ter
«211M03
<212>PRT
<213> Hämo sapiens
<400>167
EU 1537 415 Bl
I
2 MAR.2009 17=27 NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO. 078- -P. 15? ? --------
216
Leu Thr ser Thr Pha Aen Pre Arg Glu Cys Lys Leu Sex Lys Gin Glu
15 10 15
Gly Gin Asn Tyr Gly Phe Phe Leu Arg Uo Glu Lys Asp Thr Glu Gly
20 Z5 30
His Lea Val Arg Val Val Glu Lys Cys Sex Pro Ala Glu Lya Ala Gly
35 40 45
Leu Gin Asp Gly Asp Arg val Leu Arg He Asn Gly val Phe Val Asp
50 55 60
Lye Glu Glu ois Met Gin Val val Aap Leu Val Arg Lya Ser Gly Asn
85 70 73 80
Ser Val Thr Leu Leu Vel Leu Aap Gly Asp Ser Tyr Glu Ly« Ala Gly
as 90 .35
Ser Pro Gly Xle Hia Arg Asp
100
<2ia> 1S8
<211>92
<212> PRT
<21S* Homo sapiens
<400>168
Arg Leu Cys Tyr Leu Val Lys Glu Gly Gly ser Tyr Gly Phe Sex Leu
1 5 10 .15
Lya Thr Vel Gin Gly Lya Lye Gly Val Tyr Met Thx Aap Xle Thx Pro
20 '25 30
Gin Gly Val Ala Met Arg Ala Gly Val Leu Ala Aap Asp Hie Leu He
35 «0 45
Glu Vol Asn Gly Glu Asn Val Glu Aap Ala Ser Sis Glu Glu Vel Val
50 .55 60
Giu Lys Val Lya Lys Sex Gly sex Arg Vol Kat Phe Leu Leu Val Asp
65 *70 75 90
Lye Glu Thr Aap Lys Arg- Glu Phe Xla Val Tbr Asp
95 90
<210> 169
<211>112
«212> PRT
<2 J3> Homo sapiens
<400> 1S9
Gin Phe Lys Arg Glu Thx Ala Ser Leu Lye Leu-Lau Pro Hie Gin Pro
1 S 10 15
Arg Xle val Glu Met Lys Lys Gly Ser Aan Gly Tyr Gay Pha Syx Leu
20 25 30
Arg Ala Gly Ser Giu Gin Lye Gly Gla He He Lys Asp He Aap Ser
35 40 45
Gly Sex Pro Ale Glu Glu Ala Gly Leu Lys Aen Asn Aap Leu Val Val
50 55 60
AI» val Asn Gly Glu Sex val Glu Thr Leu Asp His Aep Ser Val Val
65 70 75 80
Glu Met Ue Arg Lys Gly Gly Asp Gin Thr Ser Leu Leu Val Val Aap
85 90 95
Lys Glu Thr Asp Asn Met Tyr Arg Lau Ala Glu Phe Ue Vel Thx Asp
100 105 HO
EU 1537 415 Bl
2MAR.2009 17=27 NED. OCTROOIBUREAU 43703527580 ' "0.078
ACCOUNTS
217
<210o 170
<211>9S
<212> PRT
<213> Homo sapiens
<40O17D
Pro Asp Thx Thx Glu Glu val Asp His Lys Pro Lys Leu Cys Arg Leu
1 3 10 .15
Ala Lys Gly Glu Asn Gly Tyr Gly Phe His Leu Am Ala Xle Arg Gly
20 2S 30
Leu Pro Gly Sex Phe Xle Lye diu Val Gin Lys Gly Gly Pro Ala Aap
35 40 45
Leu Ala Gly Leu Glu Asp Glu Aap Val He Uo Glu Val Asn Gly Val
50 35 60
Asn Val Leu Asp Glu Pro Tyr Glu Lys Val Vol Asp Arg Xle Gin Ser
65 70 75 80
Ser Gly Lys Asn Val Thr Leu Leu Val Glx Gly Lys Asn Ser Ser
85 90 55
<210> 171
<?11»89
<212>PRT
<213> Homo sapiens
<400>17l
Pre Thx val Pro Gly Lys Val Thx Leu Gin Lye Aep Ala Gin Aen Lau
1 5 10 13
He Gly Ha ser xle Gly Gly Gly Ala Gin Tyr cya Pro Cye Leu Tyr
20 25 30
He Val Gin Vol Phe Asp Aen Tïjr Pro Ala Ala Leu Asp Gly Thr Val
3S «0 45
Ala Ala Gly Asp Glu Xle Thr Gly Val Asn Gly Arg Sex He Lys Gly
50 55 60
Lye Thr Lys Val Glu Val Ala LPs Met He Gin Giu Val Lys Gly Glu
65 .70 75 80
Val Thx He His Tyr Aat Lya Lou Glo , .
85
<210> 172
<211>98
<212> PRT
<213> Horr» sapiens
<400>172
EU 1537 415 Bl
, 2 MAR.2009 17=28 NED. OCTROOIBUREAU 43703527580
i ACCOUNTS
-NO. 078- ? P.17-
218
Ser Gin Gly Val Gly Pro Ue Arg Ly» Vel Lau Leu Leu Lys Glu Asp
1 5 10 15
His Glu Gly Leu Gly He Ser Ile Thx Gly Gly Lye Glu Bis Gly Val
20 25 30
Pro He Leu He Sex Glu Xle fils Pro Gly Glu Pro Ala Aap Arg eye
35 40 45
Gly Gly Leu Bis Val Gly Asp Ala He Leu Ale Val Asn Gly Val Aen
30 55 60
Leu Arg Asp Thr Lye Bis Lys Glu Ala Vel Thx Xle Leu Ser Gin Gin
6S 70 75 80
Arg Gly Glu He Glu Phe Glu Val Val Tyr val Ala Pxo Glu Val Aap
85 90 95
Sex Asp
<210> 173
<211>97
<212> PRT
<213> Homo sapiens
<400>173
He Hie Val Thr Xle Leu Bis Lye Glu-Glu Gly Ala Gly Leu Gly Phe
15 10' ' 15
Sex Leu Ala Gly Gly Ala Asp Leu Glu Asn Lys Val Xle Thx val Bis
20 29 SO
Arg Val Phe Pro Asn Gly Leu Ale Ser Gl» Glu Gly Thr Xle Gin Lys
35 40 45
Gly Asn Glu Val Leu Ser Xle Asn Gly Lys Sex Leu Lye Gly Thr Thx
SQ 55 50
Hie flia Asp Ala Lev Ala lis Leu Arg Gin Ala Arg Glu Pro Arg Gin
65 70 75 80
Ala Val Xle Val Thx Arg Ly« Leu Thr Pro Glu Glu Phe Xle Val Thr
BS 90 95
Aep
<21Q> 17J
<211>98
<212>PRT
<213> Homo sapiens
<40ß>174
Thr Ala Glu Ala Ihr VSal Cys Thr Val Thr Leu Glu Lya Met Ser Ale
1 5 10 15
Gly Leu Gly Phe Sex Leu Glu Gly Gly Lye Gly Sex Leu Bio Gly Asp
20 23 30
Lya Pro Lau Thx Xle Aen Arg Xle Phe Lys Gly Ala Ala Sex Glu Gin
35 40 45
Sex Glu, Thr Val Gin pro Gly Aap Glu Ue Leu Gin Leu Gly Gly Thx
SO 55 60
Ala Met Gin Gly Leu Thr Arg Phe Glu Ala Trp Asn Xle Xle Lys Ala
65 70 75 80
Leu Pxo Aap Gly Pro Val Thr Xle Val Xle Arg Ar? Lye Ser Leu Gin
05 so - 95
EUl 537 415Bl
2 MAR.2009 17=28 NED. OCTROOIBUREAU 43703527580
ACCOUNTS
-NO. 078--------P.18
219
Ser Lys
<210>175
<2ï1>98
<212> PRT
<213> Homo sapiens
<408>175
Leg. Glu ïyx Glu Xle Thr Leu Glu Arg Gly Asn Ser Gly Leu Gly Phe
I'S 10 15
Ser Ue Ala Gly Gly Thr Asp Asn Pro His Xle Gly Aap Asp Sxo Sex
20 25 30
Ue Phe Xle Thr Lye He Xle Pro Gly Gly Ala AU Ala Gin Asp Gly
35 40 4S
Arg Lau Arg Vol Aen Asp Sex Xle Leu Phe Val Aen Glu Val Asp Val
50 55 60
Axg Glu Val Thx His Ser Ala Ala Val Glu Ala Leu Lys Glu Ala Gly
65 . 70 75 80
Sex He Vel Arg Leu Tyr Val Met Arg Arg Ly« Pro Pro Ala Glu Aan
SS 90 95
Sex Ser
<210>17B
<211> 105
<212>PRT
<2i3> Homo Seesens
<40G>17«
Hia Val Met Arg Arg Lys Pxo Pro Ala Glu Lys Val Met Glu Xle Lys
15 10 15
Leu Xle Lys Gly Pro Lys Sly Leu Gly Phe Sex Ue Ala Gly Gly Val
20 23 30
Gly Asn Gin Hi o Xle Pxo Gly Aap Asn Sex Ho Tyr Val Thr Lya He
35 40 43
Ue «u Gly Gly AI» Ala Bis Lys Aap Gly Arg Lau Gin Xle Gly Aap
SO SS eo
Lya Xle Leu Ala Val Aen Sex Val Gly Leu Glu Asp Val Met Hia Olu
6S 70 75 80
Asp Ala Val Als Ala Leu Lys Asn Thr Tyx Asp Val Val Tyr Leu Lys
85 90 95
Val Ale Lys Pro Ser Asn Ala Tyr Leu
100 '105
<2t0>177
<211>S7
<212> PRT
<2f 3> Hon» saptens
<400>177
EU 1537 415 Bl
2 MAR.2009 17=28 NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO. 078? -P.19--
220
Arg Glu Aep He Pre'Axg Glu Pro Arg Axg Xle Vel Ue Hia Arg Gly
15 ïo 15
Sex Thx Gly Leu Gly Phe Aan xle Val Gly Gly Glu Asp Gly Glu Gly
20 ' 25 30
Xle Pha He Ser Pbe Xle Leu Ala Gly Gly Pr» Ala Asp Leu sex Gly
35 40 45
du Leu Arg Lys Gly Aap Gin He Leu Spx Vol Asn Gly Val Asp Leu
50 . 55 60
Arg Asn Ala Sax Hie Glu Gin Ala Ale He Ala Leu Lye Asn Ala Gly
65 70 75 BO
Gin Thx Val Thr Xle Ue Ala Oln Tyr Lys Pro Glu Pha Xle Vol Thr
85 90 95
Aap
<210> 178
<Z1-i>8S
<212> PRT
<213> Hoir» saptens
<40ß>178
Lau Xle Arg He Thx Pro Asp Glu Aap Gly Lya Phe Gly Phe Asn Leu
1 5 .10 15
Lys Gly Gly Val Asp Gin Lya Met Pro Leu Val Val Sex Arg He Asn
20 25 30
Pro Glu Sar Pro Ala Asp Tbr Cys He Pro Lya Leu Asn Glu Gly Asp
35 40 43
Gin ile val Leu He Asn Gly Arg Aap He ser giu His Thr «is Asp
50 53 60
Gin Val Val Mat Phe Xle Lye Ala der Arg Glu Ser His Sex Axg Glu
65 70 75 60
Lau Ala Leu Val Xle Arg Axg Arg
95
<310>17S
<214>8S
<212>PRT
«c2f s> Homo sapiens
«400179
He Arg Met Lye Pro Asp Glu Asa Gly Arg Phe Gly Phe Asn vel Lye
13 10 15
Gly Gly Xyr Asp Gin Lye Met Pre Val Ue Val Sex heg Val Ala Pro
20 25 30
Gly Thr Pro Ala Asp Leu Cys Val Pro Arg Leu Asn Glu "Gly Aep Gin
35 40 45
Val Val Leu Xle Asn Gly Arg Asp He Ala Glu Hie Thr Sis Aep Gin
50 55 60
Val Val Lee Phe He Lys Ala Sex Cys Glu Arg His Ser Gly Glu Leu
63 70 7S 80
Met Leu Leu Val Axg Pro Asn Ala
i
85 i
I
I
EU 1537 415 Bl
2.MAR.2009 17=29 NED. OCTROOIBUREAU 43703527580 ' " NO.078" ? P.20?
ACCOUNTS
221
<210>180
<211>106
<212>PRT
?c213> Homo sajafens
Pro Glu Axg Glu Xla Thx Leu Val Asn Leu Lys Lye Asp Ala Lys Tyr
15 20 15
Gly Leu Gly Phe Gin Ha He Sly Gly Gl» Lys Met Gly Arg Leu Asp
20 25 30
Leu Gly Xle Phe Xle Ser Sex val Ale Pro Gly Gly Pro Ala Asp Phe
33 40 45
His Gly Cys Leu Lys pro Gly Aap Arg Leu Ue Ser Val' Asn ser val
50 55 60 ' -
Sex Leu Glu Gly Val Ser Bis His Ala Ala He Glu Xle Leu Gin Aaa
65 70 7S 80
Ala Pro Glu Asp val Thr Leu Val He Ser Gin Pro Lys Glu Lya Xle
95 90 95
Sex Lys Val Pre Sex Thr Pro Val Hie Leu
100 105
<210> 181
<211>9S
<212>PRT
<2ia> Homo sspJans
«400M81
Gly Asp He Phe Gla Val Glu Leu Ala Lye Aan Asp Asa sax Leu Gly
15 10 15
Xle Sex Vol Thr Gly Gly Vol Aan Thx Sex Val Arg Bis Gly Gly lie
20 25 30
Tyr Val Lya Ala Val Xle Pro Gin Gly Ala Ala Giu Ser Aap Gly Arg
35 40 45
He His Lya Gly Asp Arg Val Leu Ala Val Aen Gly Val Ser Leu Glu
50 SS 60
Gly Ale Thr His Lys Gin Ala Val Glu Thr Leu Arg Aen Thr Gly Gin
65 70 75 90
Val Val Hie Leu Leu« Leu Glu Lys Gly Gin Sor Pxo Thr Sar Lys
85 on
30 95
<2ïQ>ia2
<211>104
<212>PRT
<213* Homo sapiens
<tfCl0> 182
EU 1537 415 Bl
2.MAR.2009 17=29 NED. OCTROOIBUREAU 43703527580 _ ' NO.078 - -P.21-
ACCOUNTS
222
Thr Glu Glu Asn Thr Phe Glu Val Lys Leu Phe Lye Asn Gar Ser Gly
15 10 15
Leu Gly Phe Sex Phe Sex Arg Glu Asp Asa Lau Ue Pro Glu Gin He
20 25 30
Asn Ala Ser Ue val Arg Val Lya Lys Leu Phe Ala Gly Gin Pro Ala
35 40 45
Ala Glu Ser Gly Lys Xle Aap Val Gly Asp Val He Leu Lys val Asn
50 55 60
Gly Ala Ser Leu Lys Gly Leu Ser Gin Gin Glu Val Xle Sex Ale Leu
65 70 75 80
Arg Gly Thr Ale Pro Glu Val Phe Leu Leu Leu Cye Arg- Pro Pxo Pro
85 90 95
Gly Vel Leu Pro Glu Ue Asp Thr
inn
<21Q> 183
<211>98
<212> PRT
<213> Homo sapiens
<4QQ>183
Glu Leu Glu Val Glu Leu Leu He Thx Leu Xle Lye Sex Glu Lys Ala
l S 10 15
Sex Leu Gly Phe Thr Val Thr Lys Gly Aen Gin Arg Ue Gly Cye Tyr
20 25 30
Val Hie Aap Val Ue Gin Aap Pro Ala Lye Ser Asp Gly Arg Leu Lys
3S 40
Pro öly Asp Axg Leu He Lys Val Asn Asp Thr Asp Val Thx Asn Met
50 SS 60
Thx Hie Thr Aap Ale Val Asn Leo Leu Arg Ala Ala Sex Lys Thr Val
65 70 75 80
Arg Leu Val He Gly Arg Val Lau Glu Leu Pro Arg Xle Pro Hat Leu
BS 90 95
Pro Hie
<21D> 134
<211>34
<212>PRT
?^213* Homo sapiens
<400> 184
EU 1537 415 Bl
2.MAR.2009 17=29 NED. OCTROOIBUREAU 43703527580 "NO.078 P. 22-
ACCOUNTS
223
Met Leu Pro His Leu Leu Pro Asp He Thx Leu Thr Cys Aen Lys Glu
1 5 - 10 15
Glu Leu Gly Phe Ser Leu cys Gly Gly His Aap see Leu Tyr Gin Val
20 25 30
Val Tyr XI» Ser Asp Xle Asn Pro Arg Sex Val Ala Ala He Glu Gly
35 40 45
Aen Leu Gin Leu Leu Aap Vel Ue Hie Tyx Val Aan Gly Val Ser Thr
50 55 60
Gin Gly Met Thr Leu Glu Glu Val Asn Arg Ala Leu Asp Met Ser Leu
65 70 75 SO
Pxo Sex Leu Val Leu Lya Ala Thr Arg Aan Asp Leu Pro Val
65 90
<210> 185
<211>93
<212»PKT
<213> Homo ssçuens
<400> 1S5
Arg Pro Ser Pro Pro Arg Val Arg Sex Val Glu Val Ala Arg Cly Arg
I 5 10 - 15
Ala Gly Tyr Gly Phe Thx Lau Sex Gly Gin Ala Pro Cya Val Leu Sex
20 . 23 30
Cyo Val Met Arg Gly Sex Pro Ala Asp Phe Val Gly Leu Axg Ala Gly
35 40 45
Asp Gin Xle Leu Ale Val Asft Glu He Asn Val Lys Lys Ala Ser Hie
SO 55 60
Glu Aap Val Val Lys Le» Xle Gly Lys Cys Sex Gly Val Leu His Met
65 70 75 80
val Ue Ala Glu Gly Val Gly Arg Phe Glu Ser Cya Ser
63 S0
<2l0> 186
«211>9S
<212> PRT
<2l3>Hornosapfens
<4Q0>186
Leu eye Ser Glu Arg Arg Tyx Arg Glu Xle Thr He Pro Axg Gly Lys
1 S 10 . 15
Aap Gly >Phe Gly Ph« Thr Ile cys Cya Aap Sex Pre Val Arg Val Gin
20 25 35
Ala Val Asp Ser Gly Gly Pro Ale Glu Arg Âla Gly Leu Gin Gin Leu
35 40 «s
Aap Thr Val Leu Gin Lou Asn Glu Arg pro val Glu Sis Trp Lys Cye
50 55 60
Val Gla Leu Ale Aie Glu Xle Arg Ser Cya Pre Ser Glu He lie Le»
«S 70 73 60
Leu val rrp Arg Met Val Pro Gin val Lya Pro Gly He Hie Arg Aap
85 90 95
EU 1537 415 Bl
2.MAR.2009 17=30 NED. OCTROOIBUREAU 43703527580 -NO.07ET " P. 23"
ACCOUNTS
224
<21D> «87
<21f> 104
<212> PRT
<213> Homo sapiens
<4Gp> 187
Xle Sex Phe Ser Ala Asn Lye Axg Trp Thx Pro Pro Arg Ser Xle Ara
I 5 10 is
Phe Thr Ala Gl» Glu Gly Aap Leu Gly Phe Thx Leu Axg Gly Asn Ala
20 25 30
Pxo val Gin Vel Hie Phe Lau Asp Pro Tyr Cye Ser Ala Box val Ala
35 40 45
Gly Ala Arg Glu Gly Aep Tyr Xle Val Sex Xle Gin Leu. val Asp cys
SO 55 60
Lys Trp Leu Thx Leu Ser Gla Val Mat Lyo Lou Leu Lys Sax Phe Gly
«5 70 75 80
Glu Asp Glu He Giu Met Lys Val Val Ser Leu Leu Aep Ser Thx Ser
85 90 95
Ser Met His Aen Lya Sex Als Thr ' -
100
<210 168
<21î> 109
<212> PRT
<213> Homo sapiens
<4G0> 183
Arg Gly Glu Lys Lys Asn Sex Sex Sex Gly Xle Ser Gly Ser Gin Arg
15 10 IS
Arg Tyx Xle Gly Val Met Met Leu Thr Leu Ser Pro Sex Xle Leu Ala
20 25 30
Glu Leu Gin Leu Axg Glu Pro Ser Phe Pro Aep Val Gin Bis Gly Val
35 .40 45
Leu He Bis Lya V&l Xle Leu Gly Ser Pre Ala His Aro; Ala Gly Leu
50 S3 ' 60
Arg Pro Gly Asp Vel Xle Leu Ala Xle Gly Glu Gin Met Val Gin Asn
65 70 78 60
Ala Glu Asp Val Tyr Glu Ala Val Arg Thr Gin Ser Gin Leu Ala Val
85 90 95
Gin Xle Arg Arg Gly Axg Glu Thr Leu Thr Leu Tyr Val
100 105
<210> 183
<211> 111
<212> PRT !
<213> Homo sapiens ,'
I
«J00> 189 i
I
i
Glu Glu Lya Thx Val val Leu Gin Lys Lys Asp Asn Glu Gly Phe Gly !
1 5, 10 is i
Phe Val Leu Axg: Gly Ala J>ye Ala Asp ihr Pro He Glu Glu Phe Thx
20 25 30
I
i
I
EU 1537 415 Bl '
2.MAR.2009 17 = 30 NED. OCTROOIBUREAU 13703527580 'NO.078? -P.24------
ACCOUNTS
225
«y g, »* ». ^ oo. g. «, ^ tej ^ Qy £ iha im ijb
a» v<a »n, a,» si. &« «,iMlnlu ... »
frS 70 «* «y» viu «y fli. ^ ^^ Vftl ^
105 Uo
<21Q> Î9Q
<211>ï10
<212> PRT
<213> Homo sapfâns
<400> iso
Ser Asp Tyr Val He Asp Asp Lye Val Ala Val Leu Gla Lye Axg Asp
15 10 15
Ris Glu Gly Phe Gly Phe Val Leu Arg Gly Ala Lys Ala Glu Thx Pro
20 25 30
He Glu Glu Phe Thx Pro Thr Pro Ala Phe Pro Ala Leu Gin Tyr Leu
35 40 45
Glu Sex Val Asp Val Glu Gly Vol Ala tzp Arg Ala Gly Lau Arg Thx
50 53 £0
Gly Asp Phe Leu He Glu Val Aan Gly Val Asn Val Vel Lya Val Gly
65 70 75 80
Hia Lys Gin Val Val Ala Leu XI« Arg Gin Gly Gly Asn Arg Leu Val
85 90 95
Met Lys Val Vel Sex VBl Thr Axg Ly« Pro Glu Glu Asp Gly
1O0 ?-lß* ?
a05 nô
<210> 191
<211>91
<212> PRT
<213> Homo sapiens
«400>1S1
Xle Tyr Leu Glu Ale Phe Leu Glu Gly Gly Ala Pro Trp Gly Phe Shx
15 10 15
Lau Lye Gly Gly Leu Glu Hie Gly Glu Pro Lau Ha Ue Ser Lya val
20 25 90
Glu Glu Gly Gly Lye Ala Aap Thr Leu 8er Ser Lys Leo. eist Ala Gly
35 40 43
Aap Glu Val Vol Bis Xle Asn Glu Val Thr Leu Sex Ser Ser Arg Lye
50 55 60
Glu Ale Val Ser Leu Val Lys Gly Sex Tyr Lya Thx Leu Arg Leu Val
65 70 75 SO
Val Axg Arg Asp val Cys Thr Asp Pxo Gly Hie
aa
05 90-
<210> 192
EU 1537 415 Bl
2 MAR.2009 17=30 NED. OCTROOIBUREAU 43703527580
ACCOUNTS
"NO. 078- "P.25-
226
«2J1>83
<212>PRT
<213> Homo sapJens
<400> 192
Ha Arg Leu Cya Arg Leu Vel Arg Gly Glu Gin Cly Tyr Gly Phe Hie
1 . 5 10 15
Leu Hls Gly Glu Lya Gly Arg Arg Gly Gin Phe Xle Arg Arg Val Glu
20 2S 30
Pro Gly Sex Pro Ala Glu Ala Ala Ala Leu Arg Ala Gly Aap Arg Leu
35 40 45
Val Glu Val Asn Gly Val Asn val Glu Gly Glu Thr His Hie Gla val
50 55 60
Val Gin Arg Xle Lye Ala Val Glu Gly Gin Thr Arg Lan Leu Val Val
65 70 75 80
Aap Gin Aen
<21Cs* 193
<2T1>64
<212> PRT
<^13> Homo sapêns
<400>1S3
Xle Arg Hls Leu Arg Lys Gly Pro Gla Gly Tyr Gly Phe Asn Leu Bis
15 IQ IS
Ser Asp Lya Ser Arg Pro Gly Gin Tyr Ue Arg Sex val Asp Pro Gly
20 25 30
Sex Pro Ala Ale Arg Ser Gly Lira Arg Ala Gin Aep Axg Leu He Glu
35 40 45
Val Aen Gly Gin Asn val Glu Gly Leu Arg als Ala Glu val val Ale
SO 55 60
Ser Xle Lye Ala Arg Glu Asp Glu Ala Arg Leu Leu Val Val Aep Pro
65 70 75 80
Glu Thx Asp Glu
<2fÖ>1S*
<211>92
<212>PRT
<213> Homo sapiens
«KJD0>194
EU 1537 415 Bl
2.MAR.2009 17=31 NED. OCTROOIBUREAU 43703527580 " """ "' NO.078? -P.2É
ACCOUNTS
227
Pro Gly Val Axg Glu n« »«» r ^_
À r-. a 5 le Rta LBtt ^ K5 ^P «» A-V a.y Lya Thr
Gly Leu Arg Lau Arg Lya Val Aaa fll« «. , M
20 * ** **> «J» 61y Leu Phe Val Oln Leu Val
«In Ala Asn Thr pro Aia o? ^ ? , 30
3s nx Pro Ala 3er Leu val Gly Leu Arg Phe Gly Aap Gin
Leu Leu Gin Ha As»- Glv As* »L. ^ -, 4S
so «-P Gly Arg Asp Cys Ala Gly Txp Sox Sex His Lya
Ala Hia Gin Val Val Lya Lv* ay- «^ *°
çj. «x ta« Lys Ala Ser Gly Asp l*a tlm Val Val Val
Val Axg Asp Arg Pro phe Gln ^ Ihr ^ £ ^
SO
<210> 195
«21*>30
<212>PRT
<213> Homo sapiens
<4öü>195
çxy », ? j. ?, x,. «^ ln £ Sw ^ vai ^ «y ^
as ,o
«? gr e. ». v« a. g, ,. t? ?p ^ ^ £ ^ ^
S" "? ?"?' S- « «t » -. -. 2. ». .» s.r m
"? ryr giu m. n. ?^ «a« », a, «a ,s ao
?85 n-
<*210> 196
?=21 T> 103
<212> PRT
<213> Homo ssptej»
«*00> 196
EU 1537 415 Bl
2MAR.2009 17=31 NED. OCTROOIBUREAU 43703527580
ACCOUNTS
228
Leu Lys Glu Lys Thr Vel Leu Lau Gin Jtya Lys Asp Ser Glu Gly Phe
1,5 10 15
Gly Phe Vol Leu Arg Gly Ala Lys Ala Gin Tin: Pro He Glu Glu Phe
20 25 30
Thr Pxo Thr Pro Ala Phe Pro Ala Leu Gin Tyr Leu Glu Ser val Aap
35. 40 45
Glu Gly Gly val Ale Trp Arg Ale Gly Leu Arg Met Gly Aap Phe Leu
50 .55 60
Xle Glu Val Aan Gly Gin ASn Val vel Lya Val Gly His Arg Gin Val
65 70 75 80
Val Asn Met He Arg Gin Gly Gly Asn Thr Lau »et Val Lya Val Val
65 90 95
Mat Val Thr Arg Hia Pro Asp. Mat Aap Glu Ala val Gl»
100 105
<210197
<211>86
<212> PRT
<213> Homo Bspfe»s
?cäCö> 197
Leu Glu Xle Lya Gin Gly Ha Arg Glu Val Hs Leu Cys Lys Aap Gin
15 10 15
Aap Gly Lye Xle Gly Leu Arg. Leu Lys 6er Ue Asp Aan Gly He Phe
20 2S 30
Val Gin Leu val Gin Ale Asn Sor Pro Ala Ser Leu Val Gly Leu Arg
35 40 45
Phe Gly Aap Gin Vel Leu Gin Xla Asn Oly Glu Aen Cya Ala Gly Trp
50 55 60
Ser Ser Aap Lys Ala Hia Lye Val Leu Lya Gin Ale Phe Gly Glu Lya
65 70 75 80
Xle Thx Met Arg Xle Hie Arg Aap
83
c2iü> 198
<211>73
<212> PRT
<213> Homo sapiens
Arg Asp Arg Pro Pha Glu Axg Thx Ha Thr Met His Lye Aap Ser Ihr
1 5 10 15
Gly Hls Val Gly She Xle Phe Lya Affn Gly Lya He Thr Ser He Val
20 2S 30
Lys Asp Ser Sex Ale Ala Arg Asn Gly Lau Leu Thr Glu Hia Asn Ue
35 40 45
Cya Glu Xle Asn cly Gin Aon Val Xle Gly Leu Lys Aap Ser Gin Xle
50 53 60
Ala Asp Xle Leu Ser Thr Ser Gly Aan Ser ser
65 70 IS
EU 1537 415 Bl
2.MAR.2009 17=31 NED. OCTROOIBUREAU 43703527580 NO.078" P.2S-
ACCOUNTS
229
<210> 189
<211>94
<212>PRT
<213> Homo sapiens
<400>199
Gin Arg Arg Arg Val Thr Val Arg Lys Ala Aap Ala Gly Gly Lau Gly
IS io 15
He Sar Xle Lys Gly Gly Axg Glu Asn Lys Mee Pro IIa Leu Xle Sex
20 35 30
Lye Xle Phe Lya Gly Leu Ale Ale Aap Gla Thr Glu Ale Leu phe Val
33 40 45
Gly Aap Ala Xle Leu Sex Val Aen Gly Glu Asp Leu Sar sex Ala Thx
50 55 60
His Aap Glu AI» Val Gin Val Leu Iva Lys thx Gly Lys Glu Val Val
65 70 75 SO
Lau Glu Val Lye Tyr Met Lya Asp Val Ser Pro Tyr Phe Lys
85 90
<21O200
<211>69
<212> PRT
<213> Homo sapiens
<4ÖO>2G0
Xle Arg Val Val Lya Gin Glu Ala Gly Gly Lau Gly He Sex He Lya
.1 5 10 15
Gly Gly Arg Glu Aen Arg Met Pro Ue Leu Xle Ser Lys Xle Phe Pro
20 2S 30
Gly Leu Ala Ala Aap Gin Ser Arg Als Leu Arg Lau Gly Asp Ala Ue
35 40 43
Leu ser Val Asn Gly Thxr Asp Lau Arg Gin Ale Thr Hie Aap Gin Ala
50 55 60
Val Gin Ala Leu Lys Axg Ale Gly Lya Glu Val Leu Leu Glu Val Lya
65 70 75 80
Phe Xle Arg Glu Phe Ha Val Thr Aap
? as
<210>281
<211> 101
<212> PRT
<213> Homo sapiens
<4Ö0>2G1
Glu Pro Phe Tyr Ser Gly Glu Arg Thr Val Thr Uo Arg Arg Gin Thr
15 10 15
Val Gly Gly Phe Gly Leu Sex Xle Lys Gly Gly Als Giu Hie Asn XI«
20 25 30
Pro Val Val Val Ser Lye He Sex Lys «lu Gin Arg Ale Glu Leu Sex
35 40 45
Gly Leu Leu Phe Xle Cly Asp Ala Ue Leu Gin Ue Aan Gly Ue Asn
SO 55 eg
EU 1537 415 Bl
2.MAR.2009 17=32 NED. OCTROOIBUREAU 43703527580 NO.07BT P.2^
ACCOUNTS
230
Val Arg Lys Cys Arg His Glu Glu Val Val Gin Val Leu Ara Aen Ala
65 70 75 BO
Gly Glu Glu Val Thr Lau Thx Val Sex Phe L«u Lys Arg Ala Pro Ala
83 90 95
Pha Leu Lya Leu pro
100
<210>2O2
<211>99
<212> PRT
«2i$* Homo sapiens
<4Q0>202
sex His Gin Gly Arg Aan Arg Arg Thr val Thr Leu Arg Arg Gin Vtc
15 10 15
val Gly Gly Leu Gly Leu Ser Xle Lys Gly Gly Ser Glu Hie Asn Val
20 2S 30
Pro Val Val Xle Ser Lye Ha Phe Glu Asp Gin Ala Ala Asp Gin Thr
35 40 . 45
Gly Met Leu Phe Val Gly 'Asp Ala Val Leu Gin Val Aan Gly He Bis
50 55 60
Val Giu Asn Ala Thr Hia Glu Glu v«i Val -nia Leu Leu Arg Asn Ale
SS 70 75 80
Gly Aap Glu Val Thr Uo Thx Val Glu Tyr Leu Arg Glu Ala Pro Ala
65 90 95
Phe Leu Lys
«21O203
<211>&1
<212>Pf?T
<213> Homo sapiens
«!0ß>203
Arg Gly Glu. Thr Lye Glu Val Glu Val Thx Lye Thr du Asp Ala Leu
1 5 10 IS
Gly Leu Thx Ile Thr Aap Aan Gly Ala Gly Tyr Ala Phe He Lye Arg
2« 25 30
He Lys Glu Gly Ser Xle He Aon Arg He Glu Ala Vol Cys Val Gly
3S 40 45
Aap Sex Xle Glu Ala Xla Aan ASp Bis Sex He Val Gly Cya Arg His
56 55 60
Tyr Glu vel Ala Lya Met Leu Arg Glu Lau Pro Lye Sex Gin Pro Phe
65 70 75 90
Thr Leu Arg Leu Val Gin Pro Lys Arg Ala Phe
85 90
<21O204
*211»m
<212> PRT
<213> Homo sapiens
<4GO»2Q4
EU 1537 415 Bl
2.MAR.2009 17=32 NED. OCTROOIBUREAU 43703527580 NO.078' P.30"
ACCOUNTS
231
His Sex Xle Bis tie, Glu Lya Ser Aap Thr Ala Ala Aap Thr Tyr Gly
1 9 , 10 IS
Phe Ser Leu Ser Sexf Val Glu Glu Aap Gly He Arg Arg Lau Tyr Val
20 25 30
Asn Sex Val Lya Glu; Thr Gly Leu Ala Ser Lye Lys Gly Leu Lya Ala
35 40 45
Gly Asp Glu He Leu'Glu Xle Asn Asn Arg Ala Ale Aap Ale Leu aaa
50 55 60
Ser Ser Met Leu Lya Asp Phe Leu Ser Gin Pro Ser Leu Gly Leu Leu
65 70 75 OO
Val Axg Thr Tyr Pro Glu Leu' Glu
85
<210>2O5
«211>97
<212>PRT
<213> Homo safsens
?oH30>205
Pro Leu Asn val Tyr Aip Val Gin Lea Thr Lys Thr Gly 8er Val Cya
1 5 . ? 10 xs ?
Asp Phe Gly Phe Ala Vàl Thr Ala Gin Val Aap Glu Arg Gin Hie Leu
20 I 35 .30
Ser Arg He Phe Xle sor Asp Val Lau Pro Asp Gly Leu Ala Tyr Gly
35 40 45
Glu Gly Leu Arg Lys Gly Aan Glu He Met Thr Leu Asn Gly Glu Ala
SO 55 60
Val Ser Asp Leu Asp Leu Lys Gin Met Glu Ale Leu Phe Sex Glu fiys
6S 70 75 80
Ser Val Gly Leu Thr Lap. Xle Ala Arg Pro Pro Asp Thr Lye Ala Ihr
85 90 35
Leu
<210> 206
<211> 1G3
<212>PRT
<213> Homo sapiens
«J0B> 2C6
EU 1537 415 Bl
2.MAR.2009 17=35 NED. OCTROOIBUREAU A3703527580 NO.079 P.2
ACCOUNTS
232
Gin Axg Val GXu Xle Hie Lya Leu Axg Gin Gly Glu Asn Lou Uo Leu
IS xo 15
Gly Phe Sex Xle Gly Gly Gly U« Asp Gin ASP Pxo Sex Gin Aan *ro
20 25 30
Phe Sex Glu Aap Lys Thx hap Lya «ly Xle Tyr Val Thx Axg Val Sec
35 40 45
Glu Gly Gly Pxo Ala Glu Ue Ala Gly I*ra Gin He Gly A#p Lya Xle
SO 55 60
Mat Gin V«l Asn Gly Trp Asp Mat .Th* H*fc Val Tbr His Aep «In Ala
«5 70 7S eo
Aeb Lya Axg Leu Thx Lya Axg Sex Glu Glu Vnl Val Arg Leu Leu Val
85 98 93
Thr Arg ein Sox Leu Gin Lys
ipo
<210> 2D7
«211*86
<212> PRT
\ <213* Homo sapiens
<400>2D7
Are Lys Glu val Glu Val Phe Lys Ser Glu Asp Ala Lau Gly Leu Thr
15 xe IS
Ho Thr Asp A»n Sly Alo Gly Tyr Ala phe Xl« Lys Axg He Lya Glu
20 25 30
Gly Sax val Xle Aap His He His Lau Zl« aar Val Gly Aap Mat Ile
3S 40 «s
Glu Ala .Xle Asn Gly Glu Sex Leu Leu Gly Cya Axg His Tyr Glu Val
50 s$ «o
Ala Axg Leu X«u Lye Glu Leu pro Axg Gly Axg Thx Pha Thx Leu Ly*
65 70 75 60
Leu Thr Glu Pro Axg Lya
<J1O20B
<an> 91
?«212>PRT
*21S> Host» sapiens
<4flQ>209
EU 1537 415 Bl
2.MAR.2009 17=35 NED. OCTROOIBUREAU 43703527580 ' 'NO.079 '""P.3"
ACCOUNTS 5
233
Hia Ser His Pro Axg Val Val Glu Leu Pro Lys Thr Asp Qlu Gly Leu
15 10 15
Gly Phe Asn Val Met Gly Gly Lye Glu Gin Asn Sex Pw> Ue ïyx Xle
20 25 30
Sex Axg lie Xle Pro Gly Gly Val Ala Glu Arg Kis Gly Gly Leu Lys
35 40 4S
Arc Gly Asp Gin Leu Leu Sex vol nan Gly val Sex Val Glu «ly <5lu
SO 5S 60
Rio Hie Glu Lya Ala Val Glu Lau Lau Lya Ala Ala Lya Asp Sax Vol
65 70 75 80
Lys Leu Vol Val Ace Tyr Thx Pre Lya val Leu
as so
<210>209
<211>9S
<212> PRT
«=2i3> Hoîto sapiens
«J0Q>203
He Sar Aaa Gin Lya Acg Gly Val Lys Val Leu Lya Gin Glu Leu Gly
1 5 10 15
Gly Leu Gly Xla Sox Zle Lya Gly Gly Lys Glu Aan Lya Met pro He
20 25 30
Leu Xle Sac X»ys IX« phe Lys Gly i*eu Ala Ala Aap Gin Thr Gin Ala
39 '40 45
Lou Tyr val Gly Asp Ale Xla fceu Sac Val Asn Gl« Ala Aap bau Are
50 55 SO
Aap Ala Thr Ria Asp Glu Ala Val Gin Ala Leu Lya Acg Ala Gly Lye
65 TO 75 80
Glu Val Lau Leu Glu Val Lya Tyr Kat Arg Glu Ala Thr Pro Tyr Val
85 90 US
<210>21B
<21J>110
<212>PHT
«213> Homo sapiens
<4O0> 210
Xla Ola Pha Sex Asn Sex Glu Asn Cys Lys du Leu Gl» Leu Glu Lya
1 5 10 15
Hie Lys Gly Glu He Leu Gly Val val Val Val Glu Sor Cly Trp Gly
20 2S 30
5er xle Leu Pro Thr Val Xla Leu Ala Aaa (tat: Met Asn Gly Gly Fro
35 40 ag
EU 1537 415 Bl
2.MAR.2009 17:35 NED. OCTROOIBUREAU 43703527580__________________NO.079 P.4_
ACCOUNTS
234
Ala Ale Are; Sex Gly Lys Leu Ser Xle Gly Asp Gin He Met Sex He
50 SS 60
Asn Gly Thr Ser Leu Val Gly Leu pre Leu Ale Thr Cys Gin Gly Xle
?5 70 79 80
He Lys Gly Leu Lys Asn Gla. Thr Gin val Lys Leu Asn Xle Val 9er
99 90 95
Cys Pro Exo Val Thx Thr vel Leu He Lys Arg Asa Sex Ser
100 105 110
<2l0>2î1
<211>95
<212>PRT
<2l3>Momo sapiens
<4C8> 211
Zle pro Pf o Val Thx The Val Leu He Lya Are pro Aap trau Lys Tyr
15 10 15
Gin L#u Gly Phe Sex Val Gin Asn Gly Ha He Cys Sex Leu Met Are
20 25 50
Gly Gly Xle Ala Glu Ax? Gly Gly Val Arg Val Gl? Bis Arg Xla He
35 40 45
Gla Xle Asn Gly Gin Sex Val val Ala Thr Ale als Glu Lys Xla Val
50 55 60
Gin Ala Leu Ser Aen Sex Val Gly Glu He Hifi Het Lye Tbr Het Pro
65 70 75 90
Ala Ala Hat Phe. Arg Leu Leu Thr Gly Gin Glu Aen. Sex Sex
95 90
<210> 212
<211>101
<212> PRT
?<2i3> Homo sapiens
<40O212
XI« Tzp Glu Gio Hia Thr Val Thx Lou file Arg Ale Pxo Gly fine Gly
1 S 10 15
Phe Gly Xle Ale Ho Sex Gly Gly Arg Asp Asn Pro aie Phe Gin Sex
20 25 30
Gly Glu Thr Sex Ha Val 21« Ser Aep val La« Lya Gly Gly 7xo Ala
35 40 45
Glu Gly Gin Leu Gin Glu Aen Asp Axg Val Ala Msfc Val Asn Gly val
50 55 eo
Sex Met Aap Aen Val Glu Bis Ala Pha Ala val Gin Gin Leu Arg; Lya
sa 70 75 eo
Ser Gly Lys Asn Ala Lys Xle Thr Xle Are Aro Lys Lys Lys Val Gin
as 90 95
Xla pro Aan Sar Sex
100
<210> 2Î3
<211>95
<2l2> PRT
EU 1537 415 Bl
2.MAR.2009 i7:36 NED. OCTROOIBUREAU 43703527580 NO.079 P.5
ACCOUNTS ---------------------
235
<213> Homo sapiÄftB
«400*213
Xle Ser Ser Gin Pro Ala Lys Pxo Thx, Lys Val Tbr Lau Val Lya Sex
1 s 10 IS
Arg Lya Asn Glu Glu Tyr Gly Leu Arg Leu Ala Sex Hia Xle Che Val
£0 25 30
Lya Glu Xle Sex Gin Aap Sar Leu Ala Ale Arg Asp Gly Asn Xle Gin
35 . 40 45
Glu Gly Asp Val Val Leu Lya Xle Asn Gly Thr Val Thx Glu Aen Mac
50 55 eo
sex Leu Thr Asp Als Lys Thr Lau tie Glu Ars Bar Lys Gly Lya Leu
65 70 75 SB
Lys Met val Val Gin Ars Aap Arg Ala Thr Leu Leu Aen Sex sex
95 90 35
<27t» 214
?«211 > 30
<212> PRT
<213> Hojso sapiens
<400>214
Sia Arg Met Lya Leu Val Lye Ehe Arg Lys Gly Asp ser val Gly Leu
IS 10 15
Arg Leu Ala Gly Gly Asn Aap Val Gly Xle Phe Vel Ala Gly vel Leu
20 ZS 30
<31n Aap Sex Pro Als Ala Lya Glu Gly Lau Glu Glu Gly Asp Gin Uo
35 «0 49
Leu Asg val Asn Asn Val Aap rh» Ter Aan Xle Ue Arg Glu Glu Ala
50 55 60
Val Lau Bhe Leu Leu Aap Lau Pro Lya Gly Glu olu Val The Ile leu
65 70 7Ç CO
Ala Gin Lys Lys Lya Asp Val Pha Sar Asn
es so
<210> 315
<211>96
<2.2> PRT
<2I3> Homo sapleas
<400;>215
EUl 537415Bl
2.MAR.2009 17=36 NED. OCTROOIBUREAU 43703527580" ' " NO.079 "P.S"
ACCOUNTS
236
Leu He Trp Glu Gin Tyr Ihr Val Thi Leu Gin Lye Aap Ser Lya Arg
1.5 10 15
Gly Phe Gly He Ala Val Ser Gly Gly Axg Asp Aon Pro Ria Phe Glu
20 23 30
Asn Gly Glu Thr Ser Xle Val Ho ser Asp Val Leu Pro Gly Gly Pro
35 40 45
Ala Asp Gly Leu Leu Gin Glu Aen As? Arg Val Vel Met Vel Asu Gly
50 55 . $0
Thr Pro Met Glu Aap Val Leu Bis Ser Phe Ale Val Gin Gin Lau Arg
?5 70 75 ? 90
Lys Sex Gly Lys Val Ala Ala He Val Val Lya' Arg Pro Arg Lys Val
95 90 35
<210>21S
<211>79
<212>PRT
<213> Homo sapiens
Arg Val Leu Leu Hat Lya Sex Arg Ala Asa. Glu Glu tfyr Gly Lau Arg
15 10 15
Leu Gly Ser Gin Xle Phe Val Lys Glu Met Ihr Arg Thr <*ly Leu Ala
20 25 30
Thr Lys Asp Gly'Aen Leu Kis Glu Gly Asp He He Lea Ly* Xle Aan
35 «O «5
Gly Thr Val Ttix Glu Asa Met Ser Leu Thr Asp Ala Are Lys Leu Xle
50 95 «0
Glu Lya Ser Arg Gly Lya Lau Gin Leu Vax Val Leu Arg Asp Ser
65 70 75
<210>217
<211>90
<212> PRT
<213> Homo sapiens
?c400>217
Hie Ala Pro Asn Ihr Lys Met Vel Axg Phe Lye Lys Gly Asp Sex Val
15 10 IS
Gly Leu Arg Lau Ale Gly Gly Ash Aap Val Gly He Phe Val Ala Gly
2B 25 30
Xle Gin Glu Gly Thx Ser Ala Glu Gin Glu Gly Leu Gin Glu Gly Asp
35 «0 4S
Gin He Leu Lys Val Asn Thr Gin Asp Efce Arg Gly Leu Vel Arg Glu
SO 55 50
Asp Ala Val Leu Tyr Leu Leu Glu xle Pro Lye Gly Glu Met Val Thr
65 70 75 80
Xle Leu Ala Gin Ser Arg- Ala Aap Val Tyx
65 90
<210> 218
EU 1537 415 Bl
2.MAR.2009 17:36 NED. OCTROOIBUREAU 43703527580 NO.079 P.7
-------------.------------------------------"ACCOUNTS "......
237
<211>10S .
<212> PRT
«213> Homo saptens
<UOO>218
He Pro Gly Asn Ser Thr He Xxp Glu Gin Hia Thr Ala Thr Leu Sor
i S 10 ? 15
Lya Aap Pro Arg Axg Gly She Cly Ho Ala Xle flor Gly Gly Arg Asp
20 25 30
Axg Pro Gly Gly Sec Mat Val Val Sex Aap Val Vol Pro Gly Gly Pro
35 «u «5
Ala Glu Gly Arg Leu 61» Thr Gly Aap His Xle Val «at Val Aan Gly
SO 55 GO
Val Sex Hst Glu Asn Ala Thx Sex Ala Phe Ala Xle Gin Xle Leu Lye
?5 70 75 90
Thr Cys Thx Lys Met Ala Asn Xle Thr Val Lys Arg Fro Arg Axg Xle
85 90 95
Sis Leu Pro Ala Glu Phe He Val Thr Asp
. 100 ' 105
<210;>219
<211>98
«212>PRT
«213> Homo sapiens
«t*00>21S
Gin Asp Val Oln Met Lya Pro Val Lya Sex Val Lmo. Val Lye Arg Axg
1 5 10 15
Asp Sex Glu Glu Fha Gly Val Lys Leu Gly Ser. Gin Xla Phe He Lya
20 25 30
ills ile Thx Asp Sox Gly Leu Ala Als Arg His Axg Gly Leu Gin Glu
35 40 45
Gly Asp Lau He Lee Gin Xle Aan Gly Val Sor Ser Gin Asn Leu Sex
50 55 ?0
Leu Asn Asp Thr Arg Arg Leu lie Glu Lys Sor Glu Gly Lys Lau Sex
«S 70 7S 80
Leu Leu Val Leu Axg Astp Arg Gly Glu Phe Leu Val Asn Xle Pxo Asn
es 90 95
Sor Ser
<210>22D
<211> 104
«212>PRT
<213> Homo sapiens
<400>220
EU 1537 415 Bl
2.MAR.2009 17=37 NED. OCTROOIBUREAU 43703527580---------- -?-- « ?NO.079 ..._ P.8.
ACCOUNTS
238
Arg Gly Tyr sex pro Asp Thx Axg val val Arg Phe Leu Lya Gly Lys
1 5 10 15
Ser Xle Gly Leu Arg Leu Ala Gly Gly Asn Aep Vel Gly He Phe Val
20 25 30
Ser Gly Val Gin Ale Gly Sor Pro Ala Asp Gly Gin Gly Ho Gin Glu
35 40 «S
Gly Asp Gin He Leu Gin Val Asn Aap Vel Pro Phe Gin Aen Leu Thr
SO 55 60
Arg Glu Glu Ala val Gin Pho Leu Leu Gly Lau Pro Pro Gly Glu Glu
?5 7ü 75 90
Mat Glu Leu Vel Thr Gin Arg Lys Gin Asp He Phe Trp Lys H*t Val
89 90 95
Gin Ser Glu Phe Xle Val Thr Asp
200
<210>22t
<2f 1> 10
<212>PRT
<213> Homo sapiens
<4QÖ>22.
Gly Tyr Cys Axg Asn Cya Xlo Arg1 Lys Gin
15 10
<210>222
<211> 10
<212>PRT
<213> Hämo sapiens
<400>222
Trp Thx Thx Cys Met Glu Asp Leu Leu Pro
1 5 10 "
<210>223
<211> IS
<212>PRT
<21S> Homo sapiens
<400>223
Gly Xle Cye Axg Leu Cys Lya Hia Phe Gin
15 10
<210>224
<211>10
<212>PRT
*2i3> Homo sapiens
<40a>224
EU 1537 415 Bl
2.MAR.2009-17:37.___NED. OCTROOIBUREAU ?43703527580________^:.2^ _^î
ACCOUNTS
239
Lys Uly Leu Cye Arg Gla Cys lya Gin Ile
15 Iß
<210>225
<211>10
<212> PRT
<213> Homa sapiens
<MG>225
.Trp Leu Arg eye Tfcr Val Atg Xle Pro Gin
15 10
<210>226
<211>10
<212> PRT
<2ts> Homo sapiens
<4ÖO>226
Arg (Un Cye Lys Hie Phe Tyr Asn Asp Trp
15 10
<2MQ>22?
<211> 10
<212> PRT
<213> Homo sapiens
<«30>227
cys Arg Asn Cys Zle Ser Bis Glu Gly Arg
15 10
<210>228
<211> 10
<212> PRT
<213> Hanno sapiens
<9fl0>228
Cys Cyo Arg Aan Cys Tyr Glu Hia Glu Gly
1 5 10
<210>229
<211>10
<212> PRT
<213> Homo sapfens
<SQ0>229
EU 1537 415 Bl
2.MAR.2009 17=37 NED. OCTROOIBUREAU 43703527580 ".....NO.079 - -P.10
ACCOUNTS
240
Set Ser Arg ?ht. Axg teg Glu Thr Gin. Leu
15 10
<210>230
<211>10
<212>PRT
<213> Homo sapiens
<4Q0>230
Arg Lou Gla Atg Arg Acg siu The Gin Val
is la
<210>231
<211>1G
<212>PRT
<213> Homo sapiens
<4G0>231
Trp Arg &Eg Pro Arg Thr Glu Thr ©In Val
IS 10
<2ia>232
<Z11>10
<212> PRT
<213> Homo sapiens
<400>232
Trp Lya Pro Thr Arg Arg Glu Thr Glu Vol
15 10
<210>23S
<2ii>ie
<212>PRT
«c213> Homa sapiens
<400>233
Arg Axg Thr Leu Arg Arg Glu Thr Sin Vel
15 10
<21Q>234
<211>10
<212>PRT
<213> Homo sapteos
<4QÙ> 234
EU 1537 415 Bl
2.MAR.2009 17:37 NED. OCTROOIBUREAU 43703527580 NO.079 P.ll"
ACCOUNTS
241
Arg Axg Leu Thr Arg Arg Glu Thx Gin Val
15 10
<2W>235
<211> 10
<212> PRT
<213> Homo sapiens
«400^235
Axg Leu Arg Arg Arg Arg Glu Thr Gin Val
1 5 10
<210>236
<211> 10
<212>PRT
<213> Homo sapiens
<4ÖÖ>236
Arg Leu Gin Arg Arg Aôn du Thr ein Val
15 10
<Z\Q> 237
<211> 1G
«212> PR.T
«213> Honro sapiens
<40Q>237
Axg Leu Gin Arg Arg Arg Vat Thr Gin Val
15 10
<21Q>238
<211>10
<212> PRT
<213> Homo sapiens
<400>238
Thr 5er Arg Glu Pro Arg Glu Ser Thx val
1 5 , 10
<210>239
<311>1G
<272> PRT
<213> Homo sapiens
<4O0>239
EU 1537 415 Bl
2.MAR.2009 17:38 NED. OCTROOIBUREAU 43703527580 "" NO.079' -P.12-
ACCOUNTS
242
Gin Arg Gin Ala Arg Sar Glu Tbr Leu Val
15 10
<21Q>240
<311> 10
<212> PRT
<213> Hbmosrpèens
«4Q0>24Q
Arg Leu Gin Arg Arg Arg Gin Thr Gin Vel
15 10
<2I0>241
<211> iO
<212> PRT
<213> Homo sapteRS
?c400>241
Arg Leu Gin Arg Arg Arg Glu Thr Ala Leu
1 S 10
<21Ö»242
<211>10
<212>PRT
<213> Hon» sapäens
<40ö>242
Thr Sar Arg <3ln Als Thr Gla Ser Thr Val
1 S io
<210>243
«211> 10
<212>PRT
<213> Hon» sapiens
<4Ö0>243
Arg Arg Arg Thr Arg Gin Glu Thr Gin Val
î 5 io
<21Ö>2B4
<211> Î0
<212> PRT
<213> Homo savais
<4O0> 244
Arg Arg Arg Glu Ale Thr Glu Thr Gin val
15 io
EU 1537 415 Bl
2.MAR.2009 17:38 NED. OCTROOIBUREAU 43703527580' ~ NO.079- P.13-
ACCOUNTS
243
<210> 245
<211> 10
<212>PRT
<213> Homo sapiens
<4QO>245
Arg Pro Arg Ar« Gla Thr Glu Thr Gin Val
1 5 10
<210> 24S
<211> IG
<212> PRT
<213> Homo sapiens
<400> 245
Arg Hie Thr Thr Ala Thr Glu 5er Ale Val
1.5 10
<210> 247
<211>1G
<212> PRT
<213> Homo sapiens
<AQQ> 247
Thr Ser Arg Gin Ala Thr Glv 5er Thr Val
1 S 10
<210>24S
«211>10
<2t2> PRT
<213> Homo sapiens
<4C0> 248
Arg Cys Trp Arg Pro 5er Ala Thr Val Vel
1 S io
<210> 249
<211> 10
<212>PRT
<2I3> Homo Surfens
<4d0>249
Pro Pro Arg Gin Arg Ser Glu Thr Gin Val
1 5 - 10
<210> 250
<211^24
EU 1537 415 Bl
2.MAR.2009 17:38
NED. OCTROOIBUREAU
ACCOUNTS
43703527580
'NO.079 "-P.14"
244
?^12>ONA
<213> Homo sapäens
*40D>250
aaaagatda caatadatg gcgc 24
<210> 251
<211>26
<212>DNA
<21S> Homo salens
<40O>251
agggsmtec agatflaaïa tfatac 26
<21G>252
<211>26
<212> DNA
<213> Homo sapiens
<400>252
3«?aggj)tcca Ifitstgcac csaaag 26
<21Q>253
<2lt>28
<212>DNA
<213> Homo sapfens
<4G0>253
atggaattet atcfccatgc atgattec 28
<21ß>254
<21î>26
<212>DNA
<213> Homo sapiens
<40G>254
gaggaattea ccacaatad atggcg 26
<21Q> 255
«211>26
<212>DWA
?«213> Homo sapiens
<400>255
aggagafctc atacftaata ttatac 26
<210>255
<211>27
<212>DNA
<213> Homo sapiens
<4GO>256
ögsgatcttcagi-gtcgäggagtcg 27
«210>257
<211>26
<212>DNA
<213> Homo sapiens
EU 1537 415 Bl
2.MAR.2009 17:38
NED. OCTROOIBUREAU
ACCOUNTS
43703527580
NO.079 P.15-
245
?C40O257
aaagaattca tfflatgcac
<210>258
<211>26
<212> DNA
<213> Homo sgpens
«400>25S
25
28
<Sriü>235
<211>S2
<212>DNA
<213> Homo s^äens
<4D0>25S
cJgggatcct catcaacgtg ticögatga Ic
<2io>2SS
<211>27
«:212> DNA
<213> Homo sapiens
<400>2SO
32
27
<210 261
<211>29
«212>DNA
<213> Homo sapiens
<40D>261
aaïeaagctf Jatctccatg cafgattac
<21Q>2S2
<211>30
<212?0NA
«ai3> Homo sapiens
<400>262
gctgaagctf icaacgtgtt cttgatgatc
<210>263
«211>27
<212> DNA
<213? Homo sapiens
<40D>263
aagcgtcgac tKaJgcacc aaaagag
*21Q> 264
<211>29
*212>DNA
<213> Homo sapiens
<40O>264
aa^ctcgag fetrtccatg ca^gaßac
29
3Q
27
23
EU 1537 415 Bl
2.MAR.2009 17:39
NED. OCTROOIBUREAU
ACCOUNTS
43703527580
NO.079
P. 16"
246
<210>2S5
<211>30
<212> DNA
<213> Homo sapiens
<400>2fi5
o^ctcgagtcaacgfgttcttgatgafe 30
<210>266
<211>25
<212>DNA
<213> Homo sapiens
<4.Q0>Z£S
agaa$c§ac cacaatada tggcgc 26
<210>267
<211>27
<212>DWA
<213> Homo sapiens
<4Ö0>267
taggctegagcaîacttaataSatac 27
<210>268
<211>28
<212>DMA
<213j» Homo sapiens
<408>269
cttgctegagicagcgtegitggagttg 26
<21Q>269
<211>2S
<212> DMA
<213> Homo sapiens
<40O263
agaaaagcö cacaatacfet îggcgc 26
<210>270
<211>27
<212>DNA
<2l3> Homo sapiens
<c400>27D
tegaagdig catacttaat afiatac 27
<210>271
<211>28
<212>DNA
<213> Homo sapiens
<40Q>271
ctfgaagctttcagtgîcgttgaggîqg 28
<210>272
<211>225
EU 1537 415 Bl
2.MAR.2009 17:39 NED. OCTROOIBUREAU 43703527580 " NO.079" -p.17"
ACCOUNTS
247
<212> PRT
<213> Han» sapiens
«5aö0>272
Mat Sex Pxo Xle Leu Gly Tyr Trp Lya Xla Lya Gly Leo Val Gin Pxo
1 5 . IC 15
Thr Arg Lets Leu Leu Gla Tyr Lea Glu Gla Lye Tyr Gin Glu Hia Lee
20 25 30
Tyr Glu Arg Aep Glu Gly Aap Lya Trp Arg Ain Lye Lye Phe Glu Leu
35 40 45
Gly Leo Glu Pho Pro Asn Lau Pro Tyx Tyr Xle Asp Gly Asp Val Lye
50 55 ?Q
Leu Thr Gin Ser Mer Ale IIa Ile Arg Tyr Zle Ala Aep Lya Bis Aen
S5 70 75 50
Met Leu Gly oly Cya Pro Lya Glu Arg Ale Qla Uo Ser Met Leu Gla
8S 90 95
Gly Ale val Leu Asp Xle Arg Tyx Gly Val Ser Arg Ile Ale Tyr Sex
100 105 HO
Lye Aap Phe Glu Thr Leu Lye Val Alp Phe Lau Sor Lya Leu Pro Glu
115 X20 125
Met Leu Lya ttot Pfco Glu Aöp Arg Lau Cya Ble Lya Thr Tyx Leu Aen.
130 135 140
Oly Asp Hls Val Thr Hls Pro Asp Fhe Hat Leu Tyr Asp Ale Leu Ans
?145 ? ISO 155 160
Val Vel Leu. Tyr Met Aap Pro Met Cye Leu Mp Ala Phe Pro Lye Lau
165 1*70 17S
Val Cye Pao Ly» Lya Ar? Zle Glu Ale Xle Pxo Gin Sie Asp Lya Tyr
ieo ias iso
Leu Lyo Ser Ser Lya Tyr Xle Ala Trp Pro Leu Gin Gly Trp Gin Ala
195 200 205
Thx Pha Gly Gly Gly Aap Hia Pro Pro Lye Ser Aop Lee Ile Glu Gly
210 215 220
Arg
225
<210>273
<211>24
«212?-DNft
<213> Hort» sapiens
<400>273
aatggggalccagcfeaöaaagg 24
<ö10>274
<211>24
<212>DNA
<213> Homo sapäens
?OOO 274
atacatactf gtggaattpg ccac 24
<210>275
<211?-26
<212>DNA
<213> Homo sapiens
<400>275
EU 1537 415 Bl
2.MAR.2009 17:39 NED. OCTROOIBUREAU 43703527580 NO.079 'P.18~
ACCOUNTS
248
cacggafcccßcajagtigaaaggc 26
<210>276
<211>30
?*212>DNA
<Z\3> Homo sapiens
<400>27Ç
Gägaattcc atóggatca aaaggcaa^ 30
<2Î0>277
<211>30
<312>QNA
«213> Homo sapiens
<40Q>277
C3gggatecaaagagîtgaaa»f3caagc 30
<2Î0>278
<211>27
<212>ONA
s2ia> Homo sapïens
<400>278
acggaaäct gcagcgac&j cegqjtc 27
<2îO> 273
<211>23
«212>DNA
<2ia> Homo sapiens
<4Q0>279
aggafccagatgtcctecatcce 23
<21Û>2$0
«2l1>23
<212>DNA
«213> Homo sapiens
<4Û0>280
g^fteatggaragcigcacgg 23
<21Q>2ßf
<2Î1>2B
<212>DNA
<213> Homo sapiens
<400>261
agagaaHctcgagalgtefacatcce 28
<210>282
<211>27
<212>DNA
<213> Homa sapiens
<400>282
^ggaatecJ^93cagca^gaEtg 27
EU 1537 415 Bl
2.MAR.2009 17:39 NED. OCTROOIBUREAU 43703527580 NO.079 P.19
ACCOUNTS
249
<210>283
<211>25
<212>DNA
<213> Homo sapçns
<4Ü0>2S3
cteggatccg <@ccagccgg fcace 25
<210>284
<211>2S I
<212> DNA !
<213> Hon» skiers j
<400>284
gacggatccccclgdgaäcggceftcig 29 '
<210> 285 !
<211>29 !
<2125>DNA
<213> Homo saplensi !
<400> 265
gacgaattcccctgcfgcac^ccttag 29 :
<210>2S6 J
<211>25
«212> UNA
<213> Homo sapiens j
<4QQ»286
cïagasttcgggocaocoggfcacc 25 I
<210>28?
<211>82
<212> PRT
<213=>Homosaptens
c400> 287 j
Leu Ile Lys Gly Pre Lye Gly Leu Gly Pha Sex lie Ala Gly Gly Val
IS 10 is
Gly Asn Gin als Ile Pro Gly Aep Asn Ser Zle Tyr V&l Thr Lya Ile
20 25 30
Ile GlU Gly Gly Ale Ale Slù Lya Aap Gly Lye Leu Gin Ile Gly Asp
35 40 45
Lye Lau Leu Ala Val Aen Asn Val Cys Lev Glu Glu Val Thr ale Glu
50 55 60
Glu Ala Val Thr Ala Leu Lya Aan Thr Sar Aap Phe Val Tyr Leu Lys
65 .70 75 BO
Vel Ala
<210>288
<211>10i
<212>PRT
<213> Hose» ss^iens
?c400>288
EU 1537 415 Bl
2.MAR.2009 17M0 NED. OCTROOIBUREAU 43703527580 NO.079 P.20
ACCOUNTS
250
Pro Sec Glu Leu Lya Gly Lye Phe Xle ais Thr Ly«t Leu hxg Lya Sex
IS io 15
Sar Axg Gly Phe Gly Phe Thr Val Val Gly Gly Asp Glu Pro Aap Glu
20 25 30
Phe Lou Gin Xla Lya Ser Lou Val Leu Asp Gly Pro Ala Ale Lou Asp
35 40 «s
Gly Lys Met Glu Thx Gly Asp Val Xla Val Ser Val Asn Asp The Cye
50 SB ?0
Val Leu Gly Hie Thr Kla Ale Gin Val Val Lys Ile Phe Gin Ser Ile
65 70 75 00
Pro Xla Gly Ala Ser Val Asp Lee Glu Leu Cys Ans Gly Tyx Pro Leu
BS 30 OS
Pro Phe Asp Pro Asp
100
<210>283
<2U> 102
<212> PRT
<213> Homo sapiens
«400 283
Gla Arg Val Gla lia ala Lya Lan Axg Sin Gly Glu Aen Leu Xle Leu
1 '5 10 15
Gly Phe Ser XI« Gly Gly Gly Xle Aep Gin Aep Pro Sex Gin Aen Pro
20 2S 30
. Pee Ser Glu Asp Lys Thr Aap Lys Gly Ile Tyr Vel Thr Arg val ser
35 40 «5
Glu Gly Gly Pro Ala Glu Xle Ala Gly Leu Gin Ha Gly Aep Lys Ile
SO SS < 60
Het Gin Val Aan Gly Trp Asp Met Thr Mat Val Thr file Asp Gin Ala
65 70 7S 80
Axg Lys Arg Leu Thx Lye Are Ser Glu Glu Val Val ftxg Leu Leu Val
85 90 »5
Tor Ara Gin asx Lea Gin
100
<210>230
<211> 122
<212> PRT
«213» Homo saptens
EU 1537 415 Bl
2.MAR.2009 17=40 NED. OCTROOIBUREAU 43703527580 NO.079 P. 21"
ACCOUNTS
251
Hat Sax Tyr Xle Pro Gly Gin Pro Val Thr Ala Val Val Gin Axg Val
1 5 lO IS
Glu Xle His Lyfi Leu Axg Gin Gly Glu Asn Leu Ue Lau dy Plie Sex
20 ZS 30
Xla Gly Gly Gly Ile Aap Gin Aap Pro Sex Gla Aan Pro Phe sar Clu
35 '40 45
Asp Lya Thx Asp Lys Gly Ile Tyr Val Thx Arg Val Ser Glu Gly Gly
50 55 £0
Pro Ala Glu Ile Ala Gly Leu Gin Zle Gly Asp Lys Xle Met Gin Val
<S3 70 75 80
Afin Gly Tip &sp **"fc *?« Mot Val Thr 81a Asp Gin Aie Axg Lya Arg
95 90 SS
Leu Thx Lye Arg- Ser Glu Glu Val Val Arg Wu Leu Vel Thx Arg Gin
100 105 U0
Sar Leu Gin Lye Aie Val Gin Gin Sor Hot
115 12Ö
<21ö> 2S1
«S11>125
<21»PRT
<213>Hrarw sapäens
<4G0>291
Glu Met Ser Tyr II« Pro Gly Gin Pro Val Tfcx Ala Val Val Gin Axg
1 . 5 10 15
Val Glu Ile Hia Lye Leu Arg Gin Gly Glu Asn Leu Xle Lau Gly Phe
20 25 M
Ser II« Gly Gly Gly Xle Aep Gin Asp Pro Ser Gin Asa Pxo Phe Sex
35 40 «5
Glu hap Lys Thr Asp Lys Gly Xle Tyr Val Thx Arg Val Ser Glu Gly
50 55 60
Sly Pro Ala Glu Ils Ala Gly Leu Gin Ile Gly Asp Lye Zle Mat Gin
65 70 75 80
Val Aen Gly xxp Aap Met Thr »et Val Ter als Asp Gin Ala Arg Lye
BS 50 95
Arg Leu Thr Lya Arg ser Glu Glu val Val Arg Leu Leu Val Thx Arg
100 105 HO
Gin 5er Leu Gin Lyo Ala Val Sin Gin Sox Mat Leu Sex
US 120 12 S
<210>292
<211>117
<212>PRT
<213>hoüto sapiens
«4ßQ>zS2
EU 1537 415 Bl
2.MAR.2009 17:40 NED. OCTROOIBUREAU 43703527580 NO.079- "P.22
ACCOUNTS
252
Pro Gly Gin Pro Vel Thr Ala Val Val Ein Arg Val Glu Ile Hia Ly»
l 5 10 IS
Leu Arg Gin Gly Glu Aan Leu Xle Leu Gly Phe 9er Xle Glv Gly Glv
ZO 25 30
He Asp Gin Asp Pro Ser Gin Asm Pro Phe Sex Glu Asp Lye Thr Asp
35 40 . «S
Lye Gly Xle Tyr Val Tür Arg Val Ser Glu Gly Gly Pxo Aie Glu Ile ?
SO 59 ea
Ale. Gly Leu Gin Xle Gly Aap Lys IIa Met Gin Val Asn Gly Trp Aep
65 70 75 SO
Met Thr Mat Val Thr Bis Aap Gin Ala Arg Lys Axg Leu Thr .Lya Arg:
G5 90 93
ser Glu Glu Val Val Arg Leu Leu Val Ihr Arg Gin Ser Lau Gin Lys
100 105 * 110
Ale val Gin Gin sex
115
<210> 293
<211>72
<212> PRT
<213> Homo sapiens |
<4G0>293
Arg Ly» Ser Ser Arg Gly Phe Gly Phe Thr Val Val Gly Gly Asp Glu I
1 5 10 15
Pro Aep Glu Pha Leu Gin IIa Lya Ser Leu Val Leu Asp Gly Pro Ale
'20 25 30 !
Ala Lau Asp Gly Lys Het Glu Thx Gly Aep Vel IIa Vel Ser Val Aan
55 40 43
Aap Thr Cys Val Lee Gly als Thr Hie Ala Gin Val val Lys île Phe !
50 55 60 I
Gin Ser Xle Pxo Ue Gly Aie Ser
65 70 I
<210>234
<211>76
<212> PRT
<213> Homo sapfëns
<400>2Stf
Phe Ile Kls Thr Lys Leu Arg Ly« Sex Ser Arg Gly Phe Cly phe Thx
* 5 10 15
Val Val Gly Gly Aap Glu Pxo Aep Glu Phe Leu «n Ile fcys Ser Leu
20 2S 30
Val Leu Aep Gly Pro Ala Ala Leu Aap Gly Lye Met Glu Thr Gly Asd
35 40 «s
val île val Ser Vol Aan Aap Thr Cya Val Leu Gly Hie Tbc aie Ala
50 ss eo
Gin Val val Lys Ile Phe Gin Ser Ile Pro Ho <Uv
65 70 75
<210>255
<211>85
<212> PRT
I
EU 1537 415 Bl
2.MAR.2009 17:41 NED. OCTROOIBUREAU 43703527580 NO.079 P.23"
ACCOUNTS
253
<c2i3> Homo sgplens
<c40G>235
Phe zle Hls Thr Lye Leu Axg Lys Sec Sax Arg Gly Phe Gly Pha Thr
15 10 15
Val Val Gly Gly Aep Glu Pro Asp Glu Pho Leu Gin Ile Lye Sex Lau
20 25 3{J
Vol Lea Asp Gly Pro Ala Ale Lau Aep Gly Lye Mat Glu Thx Gly Aap
35 40 45
Val Ile Val Ser Val Asn Asp ihr Cya Val Leu Gly Sie Thx Hls Ala
SO 55 - «0
Gin Val Val Lys Xle Phe Gin Ser Sie Pro lie Gly Ala 9er Val Aap
65 70 75 80 -
Leu Glu Lee Cys Arg
85
<210>295
<211>7ß
<212>PRT
<213> Homo sapiens
<40B>296
Lya Ser Ser Arg Gly Phe Gly Phe Thr Val Val Gly Gly Asp Glu Pro
15 10 15
Asp Gla ?he Leu Gin Ue Lye 5er Leu Val Leu Asp Gly Pro Ala Ale
20 25 30
Leu Asp Gly Lys Met Glu Thr Gly Aap Val IIa Val Sar Val Aen Asp
35 «6 45
Thr Cys Val Leu Gly Hie Thr Hie Ale Gin Val Val Lye Ile Phe Gin
50 55 «0
Ser Xle Pxö Xla Gly Ala Sex val Aap Leu Glu Leu Cya Arg
«5 70 75
<210>29?
<211>88
<2î2> PRT '
<213> Homo sapiens
<4G0>297
Pha lie Hls Thx Lya Leu Arg Lys Ser Sex Arg Gly Phe Gly Phe Thr
15 10 15
Val Val Gly Gly Aap Glu Pro Asp Glu Phe Leu Gin île Lye Sex Lev
20 as 30
Val Leu Asp Gly Pro Ala Ala Lou Asp Gly Lye Mat Glu Thr Gly Asp
35 40 45 ?
Vhl lie val Ser Val Asa Asp Thr Cye Vol Leu Gly Hi« Thr Hie Ale
Gin Val Val Lye II« Phe Gin Ser Ile Pxo lie Gly Al* See val Asp
65 70 75 »a
I«u Glu Leu Cya Arg Gly Tyx pro
a5
EU 1537 415 Bl
2.MAR.2009 17:41 NED. OCTROOIBUREAU 43703527580 NO.079 P.24"
ACCOUNTS
254
<210> 238
<211>88
<212>PRT
<213> Horra» sapjens
<400>298
Lye Gly Lye Phe Zle Ble Thx Lys Lau Arg'Lye Sex Sex Arg Gly Phe
15 10 15
Gly Ph« Thr val Val Gly Gly Aap Glu Pro Asp Glu Phe Leu Gin Ile
20 25 30
Lye ser Lee Val Leu Asp Gly Pro Ala Ale Leu Asp Gly Lye Met Glu
3S 40 45
Thr Gly Aap Val Xle Val See Val Asn Asp Uhr Cy» Val Leu Gly Hie
50 55 60
Thr Bis Ale Gin Val Vel Lya Xle Phe Gla 8er lie Pro Ile Gly AI«
65 70 75 00
Ser Val Aap Leu Glu Leu Cya Arg
85
<210>229
<211^61
<212> PRT
<213> Hon» sapiens
<4üQ>299
Lya Gly Lys Phe Xle Hia Thr Lys Leu Arg Lys Ser sex Arg Gly Pha
15 IO 15
Gly Pha Thr Val Val Gly Gly Aap Glu Pro Aap Gl» Phe Leu Gin Xle
' 20 35 30
Lya Ser Leu Val Leu Asp Gly Pxq Ala Ale Leu Asp Gly Lye Het Glu
35 40 «S
Thx Gly Asp Val Xle val Sex Val Ash Asp Thr Cya Val Leu Gly Bis
50 55 60
Thr Rie Ale Gin Vol Val Lya He Phe Gin Sex 21b Pro Ile Gly Ala
65 70 75 80
Ser
<210>3GO
«211s» 94
<212>PKT
«213> Homo sapiens
<4CO>300
Sie Lea Lya Gly Lya Pha xle Jus Thx Lye Leu Arg Lys ser Ser Arg
15 10 15
Gly Fee Gly Phe Thr Val Val Gly Gly Asp Glu Pro Asp Glu Phe Lau
20 2& 30
Gin lie Lya Sex Leu Val Leu Aep Gly Pro Ale Ala Leu Asp Gly Lys
35 40 45
Met Glu Thr Gly Asp Vel He Val Sax Val Aon Aap Thx Cys Val Leu
50 55 «0
EU 1537 415 Bl
2.MAR.2009 17:41 NED. OCTROOIBUREAU 43703527580 NO.079 P.25
ACCOUNTS
255
Gly His Tnr Kls Ala Gin Val Val Lys Xle Phe Gla Ser Ile Pro Ile
65 70 75 , 80
Gly Ala Sax Val Asp Leu Glu Lee Cys Arg Gly Tyr Pro Leu
05 90
<210>301
<211>9S
<Zi2> PRT
«s2l&> Homo sapiens
<400>301
Ser Glu Leu Lya Gly Lys Pha XI« Hia Thr Lys Leu Arg Lye Ser Ssx
IS 10 15
Arg Sly Ph« Gly Ph« Thr Val Val Oly Gly Asp Glu Pro Aap Glu Phe
20 25 30
Leu Gin Xle Lys Sex Lea Val lieu Asp Gly Pro Ala Ale Leu Asp Gly
35 40 45
Lya Het Glu Thr Gly nap vol Xle Val Sax val Asn Asp Tor Cya Val
50 55 60
Ltu Gly Kia Thx Hia Ala Gin Val Val Lys Xle Pho Gin Ser lie» Pro
65 70 75 SO
lie Gly Ala Ser Vol Asp Leu Glu Leu Cya Arg Oly Tyr Pro Leu Pro
«S 90 95
Bhe Asp Pre
<2TÖ>382
<211>72
<212>PRT
<213> Homo sapiens
<400>302
Arg Lys Ser Ala Atg Gly Pha Gly PJte thr Val Val Gly Gly Aep Glu
15 10 15
Pro Asp Glu me Lett Gin Xle byo Ser Lea Val Lau Asp Gly Pro Ala
20 29 so
Als Leu Asp Gly Lya Mat Glu Thr Gly Aap Val Xle Val Sas Vel Asn
35 40 45
Asp Thx Cys Val Lee Gly Bis Thr Hia Ala els Val Val Lys II« Phe
50 55 GO
Gin Ser Xle Pro Xle Gly Ala Sex
65 70
<210* 303
<211>72
<2\2> PRT
<213> Homo sapiens
<4G0>3G3
EU 1537 415 Bl
2.MAR.2009 17:42 NED. OCTROOIBUREAU 43703527580 NO.079 P.26
ACCOUNTS
256
Arg Lys Sex Sex Are Gly Phe Gly Phe 7hr Val Val Gly Gly Glu Glu
15 10 15
Pro Asp Glu Phe Leu Gin Xle Lys Ser n*i val Leu Asp Gly Pro Ala
20 2$ 30
Ala Leu Aap Gly Lya Met Glu Thr Gly Asp Val Ile Vel Sar Vol Ain
35 10 45
Aap Thr Cya Val Lau Gly His Thr His Ala Gla Val Val Lys Ile Ph«
$0 5S 60
Gin Ser lie Pro Ile Gly Aie Ser
65 70
<210>304
<211>72
<212>PRT
<2i3> Homo sapiens
<uK30>304
Are Lys Ser Ser Arg Gly Phe Gly Phe Thr Val Val Gly Gly Asp Glu
15 10 15
Pro Asp Glu Phe Leu Gin Leu Lye Ser Leu Val Leu Asp Gly Pro Ala
ZQ 23 30
Ala Leu Aep Gly Lya Met Glu Thr Gly Asp Val Ile Val Ser Val Asn
35 40 45
Asp Thr Cys Val Leu Gly Sie Thr Sia Ala Gin Val Val Lys IIa Phe
SO SS eo
Gin Sex Xle Pro Ho Gly Ala Sex
65 " 70
<210>305
<211>72
<212>PRT
<213> Homo sspletîs
««00>SSS
Arg Lys Ser Sex Ar? Gly Phe Gly Phe Thr Vel Val Gly Gly Asp Glu
1 5 io 15.
Pro Asp Glu Pha Lau Gin Xla Lys Sex Leu Val Lsu Asp Gly Pro Ala
Z0 25 30
fier Lew Aap Gly Lys Het Glu TAs Gly Asp Vol Xle Vel Ser Vol Asn
3S 40 tS
Asp Thr Cys Val Leu Gly Sis Thr His Ala Gin Val Val Lya He Phe
SO SS eo
Cln Ser lie Pxù Xle Gly Ala Sax
65 7Q
<210>30S
<211>72
<212>PRT
<213> Homo sapiens
<4ÖG> 306
EU 1537 415 Bl
2.MAR.2009 17:42 NED. OCTROOIBUREAU 43703527580 NO.079 P.27
ACCOUNTS
257
Are Lya Sex Ser Arg Gly the Gly Phe Tor Val Val Gly Gly Asp Glu
l S 10 w ?
Pro Asp Glu Pha Leu Girt He Lys Ser Leu Val Leu Asp Gly Pro Ale
20 2S 30
Ala Leu Aap Gly Arg Met Glu Thr Gly Asp Vol II« Val Sex Val Asn
3S 40 45
Aep Thr Cye Val Leu Gly Hie Thr Hie Ala Gin Vel'Vel Lya He Phe
SO SS so
Gin Ser Xle Pro Ile Gly Ale Ser
65 70
<210> 307
<211>72
<212> PRT
<213> Homo sapiens
<3G0>307
Arg Lya Ser Ser Arg Gly Phe Gly Phe Tor v*l Val Gly Gly Asn Glu
1 s 10 «
Pro Aap Glu Ph« Leu Ola Ile Lys Ser Leu Val Leu Aep Gly Pro Ale
20 25 30'
Ala Leu Asp Gly Lya Mat Glu Thr Gly Aep Val lie Val Ala Val Asn
35 40 ,5
Aap Tfex eye Val Leu Gly Sis Thr Hie Ala Gin Val Val Lya Zle Phe
so 55 60
Gin Sex XI» £xo Ile Gly Ala Ser
65 70
<210> 308
<211>72
<212* PRT
<213> Hosts sapiens
<4£0>308
Arg Lys ser Ser Ax? Gly Phe Gly Phe Thr val val Gly Gly Asp Glu
IS 10 15
Pro Aap Glu Phe Lou Gin He Lys Ser Leu Vel Leu Asp Gly Pro Ale
20 25 30
Ala Lou Asp Gly Lys Met Glu Thr Gly Aep Val He Val Sox Val Aen
35 40 45
Glu Thr cy» Val Leu Gly Sie But His Ala Gin Val Val Lye Ho Phe
50 55 go
Gin Ser Xle Pro He Gly Ale Ser
6S 70
?C21O309
<211>72
<212> PRT
<21S> Homo sapiens
«4Ö0>309
EU 1537 415 Bl
2.MAR.2009 17:42 NED. OCTROOIBUREAU 43703527580 NO.079 P.28
ACCOUNTS
258
Arg Lya Ser Sex Arg Gly Phe Gly Phe Thr Val Val Gly Gly Asp Glu
IS 10 IS
'Pro Asp Glu Phe Lsu Gin Xle Lye Sex Lau Val lieu Asp Gly Pro Ala
20 2S 30
Ala Leu Asp Gly Lye Met Ola Thr Gly Asp Val Ile. Vel Sos Val Aan
âS «0 45
Asp Thx Cya Lea Leu Gly Sis Thr flis Ala Gla Val Val Lys Ile Phe
SO 55 60
Gin Ser He Pro Ho Gly Ale Ser
?5 70
<210> 310
<211>72
<212>PRT
<213> Hon» sapiens
<400>31D
Arg Lye Ser Ser. Arg Gly Phe Gly Pha Thr Val Val Gly Gly Asp Glu
I .5 10 15
Pro Asp Glu Phe. Leu Gin Ho Lys Sex Lau val Lau Asp Gly Pro Ala
20 '25 30
Ala Leu Asp Gly Lys Met Gla Thr Gly Aep Val Xle Val Ser Val Asn
33 40 45
Asp Thr Cya Val Leu Gly His Thr His Sex Gin Val Val Lys Ile Phe
50 SS «û
Gin Sex He Fro Ue Gly Ala Ser
65 70
<210>311
<211>72
<212>PRT
<2i3> Homo sapiens
<40Q>311
Arg Lya Sar Ser Arg Gly Phe Gly Phe Thr Val Val Gly Gly Asp Glu
I 5 . 10 15
Pro Asp Gltt Phe Leu Gin He Lye Sex Leu Val Leu Asp Gly Pro Ala
20 25 3D
Ala Leu Aap Gly Lya Mat Glu Ths Gly Asp Val Xle Vel Sar Val Asn
35 40 49
Asp Thr Cy» Val Leu Gly Hie Thr His Ala Gin Yal Val Lya Lou Pha
50 55 60
Gin Sex He Pro lie Gly Ala Sex
65 70
«210» 312
<211>72
<212> PRT
<2l3> Homo sapiens
<400> 312
EU 1 537 415 Bl
2.MAR.2009 17:42 NED. OCTROOIBUREAU 43703527580 NO.079 P.29
ACCOUNTS
259
Arg Lys Ser Ser Arg Gly Pha Gly Phe Thr Val Val Gly Gly Aep Glu
1 5 . 10 15
Pre ASp Glu She Lau Gin lia Lys Ser Lev. Val Leu Aap Gly Pxo Ala
20 25 3D
Ala Lea Aep Gly Lya Het Glu Thx Gly Asp Val Ile Val Sox Val Aen
35 4,0 45
Asp Thr Cys val Leu Gly His Thx His Ala Gin Val val Lys Ho Phe
50 55 £0
Gin Ser lie Pro Ile Gly sex ser
65 70
<Q.1Ü> 313
<211>?2
<212>PRT
<213>Homosapfer*s
<400»ai3
Arg Lye ser Thr Arg Gly Phe Gly Phe Thr val val Gly Gly Aep Glu
1 5 10 15
Pro Asp Git? Phe Leu Gin He Lye Sex Leu Vai Leu Amp Gly Pro Ala
20 25 30
Ala Leu Aep Gly Lye Met Glu Thr Gly Asp Val He Val Ser val Asn
35 40 «5
Asp Thr Cys val Leu Gly Hie Thx Hie Ala Gin Val Val Lye He Ph©
50 55 60
Gin Sax He Pro He Gly Ale Ser
65 70
<210>ai4
<211>72
<212>PRT
<213> Homo sapiens
«4Q0> 314
Arg Lya Sex Sex Arg Gly Phe Gly Phe Thr Vel Val Gly Gly Aap Glu
1 5 10 15
Pxo Gly Glu Phe Leu Gin Ile Lys Ser Lau Val Leu Asp Gly Pro Ala
20 25 30
Ala Leu Asp Gly ly* Mat Glu Thr Gly Asp val Ha Val Ser val Asn
35 40 45
Asp Thr Cys Val Leu Gly Bis Thx Hie Ala Gin Val Vel Lye Xle Phe
50 55 .eo
Gin Sar Ile Pro He Gly Ale Ser
65 70
<210>315
<211>72
<212>PHT
<2ia> Homo sapiens
««H>a>315
EU 1 537 415 Bl
2.MAR.2009 17:43 NED. OCTROOIBUREAU 43703527580 NO.079 P.30
ACCOUNTS
260
Arg Lys Sax Sex Arg Gly Ph» Gly Phe Thr Vel Val Gly Gly Asp Glu
1 5 ? 10 15
Pr» Aap Glu Phe Lau Gin Ile Lye Sex Leu Ale Leu Asp Gly Pro Ala
20 25 30
Ale Leu Aep Gly Lye Het Glu Thr Gly Aep Val He val Ser Val Asn
35 40 45
Asp Thr Cys vel Leu Gly Hie Thr Sie Ala Gla Val Vel Lye He Phe
SO -SS 60
Gla. Sex He Pro He Gly Ala Sex
?5 70
<2î0> 316
<211>72
<212> PRT
<213:> Homo sapiens
<400?-316
Arg Lya Ser' Ser Arg Gly Phe Gly Phe thr Val Val Gly Gly Aap Glu
15 10 15
Pro Aap Glu Phe Leu Gin He Lya Ser Leu Val Leu Aap Gly Pxo Ale
ZO 25 30
Als Leu Ala Gly Lys «et Glu Thx Gly Aep Val Xle Val Ser Val Aen
35 40 45
Aep Thr Cys Val Leu Gly Ola Thr His Ale Gin Val Val Lya Ile Phe
50 55 60
Gin Ser Ile' Pro Ha Gly Ala Ser
65 70
<210>317
<211>72
<212> PRT
<21,3> Homa sapiens
<400>317
Arg Lys S^x ser Arg Gly Phe Gly Phe Thr Val Val Gly Gly Asp Glu
15 10 15
Pro Aap Gl« Phe Leu Gin Ue Lys Ser Leu Val U&a Asp Gly Pro Ala
20 25 50
Ala Leu Asp Gly Lye «et Glu Thr Ala Aap vel He Val Ser vel Asn
35 40 45
Aap Thr Cys Vol Leu Gly His Thr Ais Ala Gin Val Val Lye Ile Phe
SO 55 60
Gin Ser Xle Pro Ile Gly Ale Ser
65 70
<2îtt» 31S
<211>72
<212>PRT
<213> Homo sapiens
EU 1537 415 Bl
2.MAR.2009 17=43 NED. OCTROOIBUREAU 43703527580 '"NO.079" ' P.31
ACCOUNTS
261
«4Q3>318
Are Lya 6 or ser Arg Gly Phe Gly Phe Thr Val Val Gly Gly Aep Glu
I 5 10 IS
Pre Asp Glu Phe Leu Gin lie Lys Ser Leu Val Leu Asp Gly Pro Ale
20 25 30
Ala Leu Asp Gly Lye Mat Glu Thr Gly Asp Val Hs Vel Ser vel Aen
35 40 45
Asp Thr Ale Val Leu Gly His Thr Hie Ala Gin Val Val Lys He Pha
SO 35 60
Gin Sex Ho Pro Ile Gly Ala Ser
65 70
<21Q>31S
«211>72
<212>PRT
<213> Hcffifio sapiens
<4QQ>319
Arg Lya Ser Sex Arg Gly Phe Gly Phe Thr Val Val Gly Gly Asp Glu
l 5 10 IS
Pro Asp Glu Phe Leu Gin Xle Lys Ser Leu Val Lau Asp Gly Pro Ala
20 25 30
ale Leu Asp Gly Lye Met Glu Thr Gly Aep Val He Val Ser Vel Asn
35 40 45
Asp Thr Cys val Leu Gly Hie Thr (lie Ala Gin Ala Val Lya He Phe
"50 55 60
Gin Ser He Pro lie Gly Ale Ser
65 70
«210> 320
*211>72
<212>PRT
<213> Ho«» sapiens
«4OG5>320
Arg Lys Ser Sar Àrg Gly Phe Gly Pha Thr val Val Gly Gly Aep Glu
IS 10 IS
pro Asp Glu Phe Leu Gin He Lye Ser Leu Val Leu Asp Cly pro Ala
20 25 30
Ala Lou Asp Gly Lye Met GloTbr Gly Asp Vel He Vel Sex Vel Asn
35 40 45
Aep Thr Cys Val Leu Gly Hie Thr Bis Ale Gin val Val Lye Ile Phe
SO 55 60
Gin Sex lie Ala Xle Gly Ala aor
65 70
<210> 321
<211> 72
<212>PRT
<213> Homo sspiens
<40D>321
EU 1537 415 Bl
2.MAR.2009 17=43 NED. OCTROOIBUREAU 43703527580 NO.079 P.32
ACCOUNTS
262
Arg Lye Ser ser Arg Gly Phe Gly Phe Thr v»i val Gly Gly Asp Giu
* 5 10 15
Pro Asp Glu Fho Leu Gl« Ile Ly« Ser leu Vel Leu Asp Gly Pro Ala
20 25 30
Ala Leu Aep Gly Lya net Glu Thr Gly Asp Val lie val ser val Aen
35 40 45
Aap Est Cye V&l Leu Gly Sis Thr Hi« Ale Gin Val Val Lys He Phe
50 SS go
Gin Ser Xle Pxo He Gly Ale Ala
65 10
<21ö>322
<211> 72
<212> PRT
<213> Homo sapiens
<4Q0>322
Arg Lyo Sor Sax Sor Gly Ph« Gly Pha The Val Val Gly Gly Aap Gin
1 s 10 ? ia
Pro Asp ©lu Phe Leu Sin He Lys Ser Lau Val Leu Asp Gly Pxo Ale
20 . 2S 30
Ala Leu Asp Gly Lye Met Glu Thr Gly Asp Val Ho Val Sax Val Aen
35 40 45
Asp ThX Cya Val Leu Gly Hia Thr Hia Ala Gin Val Val Lye He Pha
50 SS ?0
Gin Sex Ho Pro Ile Gly Ale Ser
«5 70
«210>323
<211>72
«212> PRT
<2is> Homo sapiens
<405>323
Arg Lya sex Ser Arg Gly Phe Gly Phe Thr val Val Gly Gly Leu Glu
15 iO 15
Pro Aap Glu Phe Lau Gin Ile Lys Sex Leu Val Leu Aep Gly Pro Ala
30 25 30
Ale Leu Asp Gly Lye Mot Glu Thr .Gly Asp val He Val ser val Asn
35 40 45
hsp «hr Cys Val Leu Gly Hie Thr His Alo Gin Val Val Lye lie Phe
50 55 60
Gin Sex He Pro He Gly Ala Ser
6S 70
<21i>32d
<211>?2
<212>PRT
<213> Homo sapiens
<£4G!&824
EU 1537 415 Bl
2.MAR.2009 17:44 NED. OCTROOIBUREAU 43703527580 NO.079 P.33
ACCOUNTS
263
Arg Lys Sec Ser Arg Gly Pha «ly Phe Thx Val Val Gly Gly Asp Glu
1.5 10 15
Pro Asp Glu Phe Leu Gin He Thr Ser Leu Val Leu Asp Gly Pro Ala
20 25 30
Ala Leu Asp Gly Lys «et Glu Thr Gly Asp Val lie Val Ser Val Aen
35 40 45
Asp Thr Cy» Val Leu Gly His Thr Bis Ale Ole Val Val Lys Ile Phe
SQ 55 GO
Gin Ser He Pro Ile Gly Ala Sex
65 70
<210>325
<211>72
<212> PRT
<213> Homo sapiens
<400>325
Arg Lye Sor Ser Arg Gly Phe Gly Phe Thr Val val Gly Gly Aep Glu
1 6 10 15
Pro Aep Glu Phe Leu Gin lie &ye Ser Leu Val Leu Aep Gly Pre Ala
20 25 30
Gly Leu Asp Gly Lya Hat Glu Thr Gly Asp Val He Val Ser Vol Aen
35 . 40 45
Aep Thr Cya Val Leu Gly His Thr His Ala Gin Val Vel Lye He Phe
50 55 GO
Gin Ser He Fro Xle Gly Ala Sex
65 70
<210>326
<211>72
<212>PRT
<2is> Homo sapiens
<4Q0>326
Arg Lye Sex Ser Arg Gly Phe Gly Phe Thr val vel Gly Gly Asp Glu
15 10 1$
Pro Asp «lo Phe Leu Gin He Lye Ser Leu Val Leu Asp Gly Pro Ala
SO 25 30
Ala Leu Asp Gly Lye Met Glu Thr Ser Aap Val IIa vol Sor Val Asn
3S 40 45
Asp Thx Cya Vol Leu Gly Hie Thx His Ala Gin val Val Lye He Ph«
50 55 60
Gin Ser Ua Pro lie Gly Ala Sex
6S 70
<210>327
-311>72
<212> PRT
<213> Homo sapfeos
EU 1 537 415 Bl
2.MAR.2009 17:44 NED. OCTROOIBUREAU 43703527580 NO.079 P.34
ACCOUNTS
264
«4O0>327
Arg Lya Sex Sex Arg Gly Phe Gly Phe Thx Val Val Gly Gly Asp Glu
IS 10 15
Pro Asp Glu Phe Leu Gin Xle Lys Ser Leu Val Leu Asp Gly ?ro Ala
20 25 30
Ala Leu Asp Gly Lye Met Glu Thx Gly Asp Vsl Ho Val Ser Val Lys
35 40 45
Asp Thr Cye Val Leu Gly His Thr Bio Ala Gla Val Val Lys Ile Pha
50 55 60
Gin Sor Ile Pro He Gly Ale Sar
65 70
<210>328
<2V\>72
<212>PRT
<2. 3p Homo sapiens
«400» 328
Arg Lya Ser Sex Arg Gly She Gly Phe Thr vei val Gly Gly Asp Glu
1 ^. 5 10 15
Pro Aap Glsr*£* Leu Gin He Lys 5er Leu Val Leu Aep Gly Pro Ale
20 * 25 30
Ale Leu Aap Gly Lyn Met Glu Thr Gly Aap Val IIa Val Ser Val Asn
35 40 45
Asp thr Cys Val Lau Phe Ria Thr Kis Ala Gin Val Val Lys Ile Phe
50 55 ?0
Gin Sex He Pro Ha Gly Ala Ser
65 70
<210>32$
<2rt1>72
<212>PRT
«213> Homo sapiens
<400>323
Arg Lys Ser Sor Axg Gly Pha Gly Phe Thr Val Vol Gly Gly Asp Glu
15 10 15
Pro Aep Glu Phe Leu Gle He Lya Sex' Lau Val Leu Aap Gly Pro Ala
20 25 30
Ala Leu Asp Gly Lya Hat Giu Thx Gly Asp Val 3Jlo Vel Ser Vel Asa
35 40 4S
Asp Thr Cys Val Leu Gly Hie Thr His Ale Gin Aan v«l Lys He Phe
SO 55 60
Gin Ser He Pro lie Gly Ala Sex
65 70
<210> 33D
<211»72
<212> PRT
<213> Homo sapiens
<400>330
Arg Lye Sox Sex Axg Gly Pho Gly Pha Thx v«l Val Gly Gly Asp Glu
3S 10 15
pro Aap Glu Phe Lau Gin Xle Lys Sax Leu Val Lau Asp Gly pro Ala
20 ' 25 30
Ala Leu Asp Oly Lys net Glu Thx Gly Asp Val He Vol Sex Val Asn
35 40 «5
Aep Thx Cys Val Leu Gly Rio Thr Ris Ala Gin Vnl Val Lya Xle Phe
50 55 60
Gin Sex lia Pro He Sar Ala Sex
63 70
EU 1537 415 Bl
2.MAR.2009 17:44 NED. OCTROOIBUREAU 43703527580 NO.079 P.35
ACCOUNTS
265
CONCLUSIES
1. Werkwijze voor het bepalen of een humaan persoon is geïnfecteerd met een
oncogene stam van humaan papillomavirus (HPV), waarbij de werkwijze omvat:
5
het in contact brengen van een monster dat is verkregen van de persoon met een
PDZ-domein polypeptide dat een Magi-1 PDZ-domein 2 omvat; en
het detecteren van de aanwezigheid van elk oncogeen HPV E6-eiwit dat is ge-
bonden aan het PDZ-domein polypeptide door het gebruik van een HPV bin-
10 dende partner,
waarbij de aanwezigheid van oncogeen HPV E6-eiwit aangeeft dat de persoon is geïn-
fecteerd met een oncogene stam van HPV.
15 2. Werkwijze volgens conclusie 1, waarbij het PDZ-domein polypeptide bindt aan
HPV E6-eiwit dat wordt gecodeerd door HPV-stammen 16,18 en 45.
3. Werkwijze volgens conclusie 1 of conclusie 2, waarbij het PDZ-domein polypep-
tide aan een vaste drager is gebonden.
20
4. Werkwijze volgens conclusie 3, waarbij het PDZ-eiwit op directe of indirecte
wijze aan de vaste drager is gebonden.
5. Werkwijze volgens conclusies 1-4, waarbij de PDZ-bindende partner een gemerkt
25 antilichaam is dat bindt aan het oncogene HPV E6-polypeptide.
6. Werkwijze volgens conclusies 1-5, waarbij het monster een cervicale afschra-
ping, biopsie of lavage is.
30 7. Werkwijze volgens conclusies 1-6, waarbij de werkwijze wordt uitgevoerd in
samenhang met histologische analyse van het monster als deel van een test op baar-
moederhalskanker.
EU 1537 415 Bl
2.MAR.2009 17:45 NED. OCTROOIBUREAU 43703527580 NO.079 P.36
ACCOUNTS
266
8. Werkwijze volgens conclusies 1-7, waarbij de werkwijze een ELISA of een sand-
wich test is.
9. Werkwijze volgens conclusies 1-8, waarbij het PDZ-domein polypeptide een fu-
5 sie-eiwit is.
10. Kit voor het testen op de aanwezigheid van oncogeen HPV E6-eiwit in een hu-
maan monster, waarbij de kit omvat:]
10 een eerste bindende partner voor een oncogeen HPV E6-eiwit, waarbij de eerste
bindende partner een PDZ-domein eiwit is dat een Magi-1 PDZ-domein 2 omvat;
en
een tweede bindende partner voor het oncogene HPV E6-eiwit dat in oplossing is.
15 11. Kit volgens conclusie 10, waarbij het PDZ-domein eiwit aan een vaste drager is
verbonden.
12. Kit volgens conclusie 10, waarbij de vaste drager van de kit een teststrip is en de
eerste bindende partner is gelokaliseerd op een specifiek gebied van de teststrip,
20
13. Kit volgens één van de conclusies 10-12, waarbij het PDZ-domein peptide bindt
aan het HPV E6-eiwit dat wordt gecodeerd door HPV-stammen 16, 18 en 45.
14. Gebruik van een PDZ-domein polypeptide dat een Magi-1 PDZ-domein 2 omvat
25 voor het bepalen in een in vitro test of een humaan persoon is geïnfecteerd met een on-
cogene stam van humaan papillomaviras (HPV).
EU 1537 415 Bl
2.MAR.2009 17:45
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.079 P.37
15
267
Vertaling tekst tekeningen
Fig. 1 = Figuur 1
HPV11-E6 versus HPV18-E6 binding to TIP1-
TlPl-IgG/aE6ab
Binding van HPV11-E6 versus HPV18-E6 aan
TTPl-TTPI-IgG/aEôab
5 Fig. 3 = Figuur 3
10
GST-depleted mouse Cl (BaJb/c) antisera GST-geledigde antisera van muis Cl (Balb/c)
Serum titration Titratie van serum
Fig. 5 = Figuur 5
pull down verwijdering
Fig. 8 = Figuur 8
Number of cells Aantal ceUen
Signal binding Signaal van binding
Fig. 9 = Figuur 9
Net mass Netto massa
Longer exposure Langere blootstelling
Transfected Getransfecteerd
Mock transfected Nagebootst getransfecteerd
million cells miljoen cellen
Cell lysates Cellysaten ?
Fig. 10 = Figuur 10
Cells
Cellen
EU 1 537 415 Bl
2.MAR.2009 17:45
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.079 P.38
268
FIG.1
HPV11-EÖ versus HPV18-E6 binding to TtP1-TiP1-tgG / a - & sb
4.500,
HPVm-
T1P1-
TWI-lflG
HPV11SB
? an« 68
ab
HPV18*
7TP1«
?rtPl-tgG
HPV1BE6
? antJEBai
EU 1537 415 Bl
2.MAR.2009 17:46
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.079
P. 39
269
<v& 4" ¥fc v
ji c s P
fe to fe 3
© o o w
HH
O
LL
Uiuowv
EU 1537 415 Bl
2.MAR.2009 17=46
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.079 P.40
270
GST-depleted Mous« Cl (Balb/c) antisera
-?-C1: HPVtS
-*-Cï:ÔST
-B-pC1:HPV18
1:500 1:1000 1:2000 1:4000 1ÄKJO
Sorum Titration
FIG.3
EU 1 537 415 Bl
2.MAR.2009 17:46
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.079 P.41
271
RG.4
-ttBP-e*4a(niyBatM
-MBPMgft4«[nPBa
GST-Magi1
B GST-Syn2bp
a 1.8 ??Ä
f i it ii
-S g J g ç S
S
MBP*6B cone, (ug/mL)
° 3 <s <| e> S.
WBP-?B coTio. (ug/mL)
GST-TTp1
D GST-S«tt
"T
tf 3 ** ^
ffl&P-Ëft-ISconc. (ugfttrt.}
BflBP»ES<ia cons. (uqAriL)
EU 1537 415 Bl
2.MAR.2009 17:46
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.079 P.42
272

2
?mm
m
o
LL.

EU 1537 415 Bl
2.MAR.2009 17:47
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.079 P.43
273
»
m
CM
SSSS
?MC
(O
EU 1537 415 Bl
2.MAR.2009 17:47
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.079 P.44
274
UL
SSSS i\
38 52 s
EU 1 537 415 Bl
2.MAR.2009 17:47
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.079 P.45
275
< Vs
3 x a
0 <s 0
H 1
CO CO "»fr CM Q
Cf O O Ö
[tun ostr V] Buiputq |bu6|»
EU 1537 415 Bl
2.MAR.2009 17:47
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.079
P.46
276
05
CD
EU 1537 415 Bl
2.MAR.2009 17:48
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.079 P.47
277
LU
EU 1537 415 Bl
2.MAR.2009 17:48
NED. OCTROOIBUREAU 43703527580
ACCOUNTS
NO.079 P.48
278
%
"3 J' '?. v-. ?
O

X
EU 1537 415 Bl